PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc05g012050.2.1
Common NameLOC101262914
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family YABBY
Protein Properties Length: 159aa    MW: 17732.1 Da    PI: 9.0774
Description YABBY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc05g012050.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1YABBY150.61.5e-4621452163
               YABBY   2 dvfssseqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtsllsvnlakasqllaaeshldeslkeelleelkveeenlksnvekeesa 92 
                         d ++sse++Cyv+CnfCnt+lav +P++ l+ +vtv+CGhC++l  ++ +                  +++ +  +++ n++ + ++ +++
  Solyc05g012050.2.1   2 DYVQSSEHLCYVRCNFCNTVLAVGIPYKRLMDTVTVKCGHCSNLSFLTTRP-----------------PIQGQCFDHQPNIQGYCSELKNK 75 
                         7789**************************************985543333.................23333344444444444444443 PP

               YABBY  93 stsvsseklsenedeevprvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahf 163
                          +  ss++ s++++  +p++p v++PPek+ r Psaynrf+keeiqrik++nP+i hreafsaaaknWa +
  Solyc05g012050.2.1  76 GQASSSTS-STSSEPLSPKAPFVVKPPEKKHRLPSAYNRFMKEEIQRIKSENPEIPHREAFSAAAKNWARY 145
                         33333322.566777899999************************************************75 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046907.4E-546145IPR006780YABBY protein
SuperFamilySSF470953.01E-989144IPR009071High mobility group box domain
Gene3DG3DSA:1.10.30.108.6E-699144IPR009071High mobility group box domain
CDDcd013902.52E-6106142No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010254Biological Processnectary development
GO:0010582Biological Processfloral meristem determinacy
GO:0048479Biological Processstyle development
Sequence ? help Back to Top
Protein Sequence    Length: 159 aa     Download sequence    Send to blast
MDYVQSSEHL CYVRCNFCNT VLAVGIPYKR LMDTVTVKCG HCSNLSFLTT RPPIQGQCFD  60
HQPNIQGYCS ELKNKGQASS STSSTSSEPL SPKAPFVVKP PEKKHRLPSA YNRFMKEEIQ  120
RIKSENPEIP HREAFSAAAK NWARYLPNPP NSGNTNNV*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.103630.0flower
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO43812020.0
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Detected during flower and leaf development. Expression in the flower meristem in the early stage of flower development. When carpel primordia begin to form, specific and uniform expression in carpel primordia. Expression in the central region of the leaf plastochron 1 (P1) primordia. Detected up to P4 stage, hardly detected in the P5 leaves. {ECO:0000269|PubMed:14729915}.
Functional Description ? help Back to Top
Source Description
UniProtRegulates carpel specification in flower development. Severe or intermediate mutation in DL causes complete or partial homeotic conversion of carpels into stamens without affecting the identities of other floral organs. Interacts antagonistically with class B genes and controls floral meristem determinacy. Regulates midrib formation in leaves probably by inducing cell proliferation in the central region of the leaf. {ECO:0000269|PubMed:14729915}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00220DAPTransfer from AT1G69180Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc05g012050.2.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004239032.11e-116protein CRABS CLAW isoform X2
SwissprotQ76EJ01e-61YABDL_ORYSJ; Protein DROOPING LEAF
TrEMBLA0A3Q7GFI61e-115A0A3Q7GFI6_SOLLC; Uncharacterized protein
STRINGSolyc05g012050.2.11e-116(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA52102339
Representative plantOGRP90691114
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69180.13e-61YABBY family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]