PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc05g009720.2.1
Common NameLOC101263023
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family G2-like
Protein Properties Length: 401aa    MW: 44023.2 Da    PI: 7.0238
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc05g009720.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1031.9e-32220275156
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                         k+r++W+peLH+rF++a++qLGGs++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  Solyc05g009720.2.1 220 KQRRCWSPELHRRFLHALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLH 275
                         79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.542217277IPR017930Myb domain
Gene3DG3DSA:1.10.10.608.0E-29218278IPR009057Homeodomain-like
SuperFamilySSF466891.79E-18218278IPR009057Homeodomain-like
TIGRFAMsTIGR015573.1E-27220275IPR006447Myb domain, plants
PfamPF002491.6E-7222273IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009737Biological Processresponse to abscisic acid
GO:0055062Biological Processphosphate ion homeostasis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 401 aa     Download sequence    Send to blast
MMSNNNFSDK MERCQQYIDA LEQERTKIQV FSRELPLCLE LVTQAIETYK QQLSGTTTEY  60
NLNAQSTECS DDEHTSSDVP ILEEFIPLKS TFSHEDEDED ENDEENQSHK SKSFNNNNNN  120
STSSKDAKNK KSDWLRSVQL WNQTSDPTPK EELTPKKVSV VEVKKNGSGG AFHPFKKEKN  180
TVAAVETTPA LAGVVLAATG SSTAENSGGS KKEDKDGQRK QRRCWSPELH RRFLHALQQL  240
GGSHVATPKQ IRELMKVDGL TNDEVKSHLQ KYRLHTRRPS PSSIHNNNNQ QPPQFVVVGG  300
IWVPPPEYAS MAAGAPAASG EASGVANSNG IYAPIATHPK GPLHDHVSGG TLRQHNNKSS  360
RSERSSERDR SHSHSDCGGV HSNSPATSSS THTTTASPAY *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A5e-13220273255Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B5e-13220273255Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A6e-13220273154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B6e-13220273154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C6e-13220273154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D6e-13220273154Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A5e-13220273255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C5e-13220273255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D5e-13220273255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F5e-13220273255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H5e-13220273255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J5e-13220273255Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.113340.0callus| root
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in phosphate homeostasis. Involved in the regulation of the developmental response of lateral roots, acquisition and/or mobilization of phosphate and expression of a subset of genes involved in phosphate sensing and signaling pathway. Is a target of the transcription factor PHR1. {ECO:0000269|PubMed:27016098}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00218DAPTransfer from AT1G68670Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc05g009720.2.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced under phosphate deprivation conditions. {ECO:0000269|PubMed:27016098}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004238956.10.0transcription factor HHO2
SwissprotQ8VZS31e-100HHO2_ARATH; Transcription factor HHO2
TrEMBLA0A3Q7GFL80.0A0A3Q7GFL8_SOLLC; Uncharacterized protein
STRINGSolyc05g009720.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA52192438
Representative plantOGRP54151221
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68670.15e-85G2-like family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]
  2. Nagarajan VK,Satheesh V,Poling MD,Raghothama KG,Jain A
    Arabidopsis MYB-Related HHO2 Exerts a Regulatory Influence on a Subset of Root Traits and Genes Governing Phosphate Homeostasis.
    Plant Cell Physiol., 2016. 57(6): p. 1142-52
    [PMID:27016098]
  3. Sun X, et al.
    The GARP/MYB-related grape transcription factor AQUILO improves cold tolerance and promotes the accumulation of raffinose family oligosaccharides.
    J. Exp. Bot., 2018. 69(7): p. 1749-1764
    [PMID:29385617]