PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc05g009310.2.1
Common NameLOC101253781
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family CO-like
Protein Properties Length: 438aa    MW: 49815.7 Da    PI: 5.5382
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc05g009310.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box28.72.8e-091759440
            zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg......Htvv 40
                        r C+++ +k+++++C  ++ +lC++C  + H+       H++v
  Solyc05g009310.2.1 17 RACDNCIKKRARWYCPADDAFLCQNCDASVHSAnplarrHERV 59
                        67*****************************657888888876 PP

2CCT68.22.2e-23380423144
                 CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                         Rea+++RY+eKr+tR+F+KkirYe+RK +Ae+RpR+KGrFvk+a
  Solyc05g009310.2.1 380 REARVTRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRA 423
                         9*****************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003365.6E-111461IPR000315B-box-type zinc finger
PROSITE profilePS5011910.8221461IPR000315B-box-type zinc finger
PfamPF006432.0E-71759IPR000315B-box-type zinc finger
CDDcd000219.30E-111761No hitNo description
PfamPF062037.4E-18380422IPR010402CCT domain
PROSITE profilePS5101716.122380422IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0016020Cellular Componentmembrane
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 438 aa     Download sequence    Send to blast
MVSERKLASA MGGKTTRACD NCIKKRARWY CPADDAFLCQ NCDASVHSAN PLARRHERVR  60
LKTSSLKQTS SPSSSSDDYF PDLESPLSIS SVSVSVSVPS WHRGFTRKAR TPRQGRKASK  120
SAGDGDVIRK NPIHLVPEIL SDENSLDENE EEQLLYRVPI LDPFVGHLYS SSTAPTDADS  180
EFKLESKEMT LQDDICNVDL NRFHEMLPSE MELAEFAADV ESLLGKGLDD ESFDMEGLGL  240
LGVCNKEENS MISHEKVKIE DEGEMEVVTK TTSPTTHNHQ YNHTHDHDID INEDTFEFKF  300
DYDSSINIIG DDEVVTNDEN KKKILLNLDY EGVLKAWADQ RCPWTNGERP ELDSNESWPD  360
CMGNYMGIMN ENVTIVDRGR EARVTRYREK RRTRLFSKKI RYEVRKLNAE KRPRMKGRFV  420
KRANFVTTST PNYPLVK*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1390406RRTRLFSKKIRYEVRKL
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.82770.0callus| flower| leaf
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc05g009310.2.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004238926.10.0zinc finger protein CONSTANS-LIKE 16-like
TrEMBLA0A3Q7H6X20.0A0A3Q7H6X2_SOLLC; Uncharacterized protein
STRINGSolyc05g009310.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA15392470
Representative plantOGRP8021649
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25440.12e-77B-box type zinc finger protein with CCT domain
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]