PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc05g008050.1.1
Common NameLOC101252281
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family HD-ZIP
Protein Properties Length: 210aa    MW: 23986 Da    PI: 6.5212
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc05g008050.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.84.5e-1983137256
                         T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         rk+ ++tk+q   Lee F++n++++ +++e LA++l+L+ rqV vWFqNrRa+ k
  Solyc05g008050.1.1  83 RKKLRLTKQQSFLLEESFRQNHTLNPKQKEALAMQLKLKARQVEVWFQNRRARSK 137
                         78889************************************************98 PP

2HD-ZIP_I/II111.27.1e-3683171189
         HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLre 89 
                         +kk+rl+k+q+ lLEesF+++++L+p++K++la +L+l++rqv+vWFqnrRAR k+kq+E+++e+Lkr++ +l+e+n+rL+keveeLr+
  Solyc05g008050.1.1  83 RKKLRLTKQQSFLLEESFRQNHTLNPKQKEALAMQLKLKARQVEVWFQNRRARSKLKQTEMECEYLKRWFGSLSEQNQRLKKEVEELRA 171
                         69*************************************************************************************94 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.5E-1761137IPR009057Homeodomain-like
SuperFamilySSF466891.63E-1869140IPR009057Homeodomain-like
PROSITE profilePS5007116.82779139IPR001356Homeobox domain
SMARTSM003894.4E-1681143IPR001356Homeobox domain
CDDcd000862.48E-1482140No hitNo description
PfamPF000462.0E-1683137IPR001356Homeobox domain
PROSITE patternPS000270114137IPR017970Homeobox, conserved site
PfamPF021832.6E-10139173IPR003106Leucine zipper, homeobox-associated
SMARTSM003406.0E-20139182IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 210 aa     Download sequence    Send to blast
MEIMPENSTC LELTMSIPGS SSNSSSFPSS GEGGGGRYNM MRELDINQIP SNINEEEISM  60
EEEEEEESSN NNNNNDNING APRKKLRLTK QQSFLLEESF RQNHTLNPKQ KEALAMQLKL  120
KARQVEVWFQ NRRARSKLKQ TEMECEYLKR WFGSLSEQNQ RLKKEVEELR AMKVGPPTVL  180
SPHSCHPLPA STLTMCPHCE RVTRTNVRD*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1131139RRARSKLKQ
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in seedlings, roots, leaves, nodes, internodes, flowers and embryo. {ECO:0000269|PubMed:10732669, ECO:0000269|PubMed:17999151}.
UniprotTISSUE SPECIFICITY: Expressed in seedlings, roots, leaves, nodes, internodes, flowers and embryo. {ECO:0000269|PubMed:10732669, ECO:0000269|PubMed:17999151}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription repressor that binds to the DNA sequence 5'-CAAT[GC]ATTG-3'. {ECO:0000269|PubMed:10732669}.
UniProtProbable transcription repressor that binds to the DNA sequence 5'-CAAT[GC]ATTG-3'. {ECO:0000269|PubMed:10732669}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc05g008050.1.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2387411e-129Solanum lycopersicum chromosome 05 clone C05HBa0078I05, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004238836.11e-153homeobox-leucine zipper protein HOX3
SwissprotQ0JKX12e-76HOX3_ORYSJ; Homeobox-leucine zipper protein HOX3
SwissprotQ9XH382e-76HOX3_ORYSI; Homeobox-leucine zipper protein HOX3
TrEMBLA0A3Q7GDV01e-120A0A3Q7GDV0_SOLLC; Uncharacterized protein
STRINGSolyc05g008050.1.11e-152(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA29024186
Representative plantOGRP19616156
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01430.11e-60homeobox-leucine zipper protein 17
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]