PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc05g007890.2.1
Common NameLOC101248294
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family G2-like
Protein Properties Length: 340aa    MW: 38069.9 Da    PI: 7.5215
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc05g007890.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1062.1e-332276155
             G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                        kprl+Wtp+LH+rFv+av+qLGG++kAtPk+++++m+++gLtl+h+kSHLQkYRl
  Solyc05g007890.2.1 22 KPRLKWTPDLHQRFVDAVSQLGGPDKATPKSLMRVMNIHGLTLYHLKSHLQKYRL 76
                        79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.2241979IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.7E-312077IPR009057Homeodomain-like
SuperFamilySSF466894.48E-162178IPR009057Homeodomain-like
TIGRFAMsTIGR015571.9E-232277IPR006447Myb domain, plants
PfamPF002495.1E-82475IPR001005SANT/Myb domain
PfamPF143792.1E-22149196IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 340 aa     Download sequence    Send to blast
MALHQNAQQN KDMNLVLSSD AKPRLKWTPD LHQRFVDAVS QLGGPDKATP KSLMRVMNIH  60
GLTLYHLKSH LQKYRLGKSS VTDQSFDENK QEVKLDLCEI VPNDDDTKGN EISRGLKQRT  120
YFDTELPQSD HKLSLGVCDG SQNHMNESFQ IARALQMQMD VQRKLHHQIE VQRHLQLRIE  180
AQGKYLQSVL KKAQETLAGY GTSSGVELAK AELSQLVSMV NMGCCPSSSL TEIDCSISKD  240
IENKTSKEGI LCSIESSLTS SESSARKEGQ NNSMNNKNTT CIGLPLNQES KGKKRGRHNI  300
CGDEQSSAKR YLETIDLNRK CPNEYDENVT KVIDLNEYS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A6e-202178158Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B6e-202178158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A7e-202278157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B7e-202278157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C7e-202278157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D7e-202278157Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A6e-202178158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C6e-202178158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D6e-202178158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F6e-202178158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H6e-202178158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J6e-202178158Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc05g007890.2.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004238822.10.0myb family transcription factor PHL8
SwissprotF4I2747e-74PHL8_ARATH; Myb family transcription factor PHL8
TrEMBLA0A3Q7GAK00.0A0A3Q7GAK0_SOLLC; Uncharacterized protein
STRINGSolyc05g007890.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA60361932
Representative plantOGRP7817262
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69580.13e-74G2-like family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]