PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc05g007880.2.1
Common NameLOC101248009
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family Dof
Protein Properties Length: 442aa    MW: 49069.2 Da    PI: 6.5696
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc05g007880.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.32e-39110170262
              zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                         ++k ++cprC+s++tkfCyynny+++qPryfCk+C+ryWt+GG++rnvPvG+grrknk+ss
  Solyc05g007880.2.1 110 PDKLIPCPRCNSMETKFCYYNNYNVNQPRYFCKNCQRYWTAGGTMRNVPVGSGRRKNKSSS 170
                         78999*****************************************************875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-28110167IPR003851Zinc finger, Dof-type
PfamPF027014.9E-32112168IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.5114168IPR003851Zinc finger, Dof-type
PROSITE patternPS013610116152IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 442 aa     Download sequence    Send to blast
MSEVRDPSIK LFGKTIGMTQ QETNCVYLHD DHTTSSPLSI DDEKINLEGE VTQSKQVDEL  60
VDPAADSSIE PETSSGISDD IKMQDADKET LSSKSVEEED SSEEKALKKP DKLIPCPRCN  120
SMETKFCYYN NYNVNQPRYF CKNCQRYWTA GGTMRNVPVG SGRRKNKSSS ISNYPLQAGR  180
VEAAAHGMHL PASRTNGTVL TFGSDKPLCD SMVSALNLAE NSHNMHRNEY HGSEQRMPTI  240
GNDQSNGSCS TASSVTDKES SAGTHDLANW SNFQPFPPQV PYFQGAPWPY SGFPVSFYPA  300
APYWGCTVSN PWNVPWLSSN QSVHNNSPTS PTLGKHSRDE SKLDPSQSRR RDTTLQDREG  360
ERCVLIPKTL RIHDPNEAAK SSIWSTLGIR NEKIDSTRGT MLFSAFNPKA DHRNRELDTS  420
FALQANPAAL SRSLHFREST R*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.149350.0flower| fruit| leaf
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc05g007880.2.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004238821.10.0cyclic dof factor 1 isoform X1
TrEMBLA0A3Q7GDS70.0A0A3Q7GDS7_SOLLC; Uncharacterized protein
STRINGSolyc05g007880.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA53224122
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.27e-79cycling DOF factor 2
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]