PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc05g007770.2.1
Common NameLOC101244582
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family NAC
Protein Properties Length: 283aa    MW: 32498.7 Da    PI: 7.3712
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc05g007770.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM168.91.7e-5291341128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                         lppGfrFhPtdeel+++yL+ +++++++++ ++i+e+d+yk++Pw Lp+k++ +++ewyfF++rd+ky++g r+nra+ sgyWkatg+dk+
  Solyc05g007770.2.1   9 LPPGFRFHPTDEELIMYYLRYQATSRPCPV-SIIPEIDVYKFDPWVLPEKAEFGDNEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKA 98 
                         79****************************.89***************99999************************************** PP

                 NAM  92 vlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         ++s  ++ vg+kk Lvfykg+ pkg+ktdW+mheyrl
  Solyc05g007770.2.1  99 IYS-ANKYVGIKKALVFYKGKPPKGVKTDWIMHEYRL 134
                         ***.8899***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019418.37E-655161IPR003441NAC domain
PROSITE profilePS5100560.5759161IPR003441NAC domain
PfamPF023655.7E-2610134IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 283 aa     Download sequence    Send to blast
MVGKISSDLP PGFRFHPTDE ELIMYYLRYQ ATSRPCPVSI IPEIDVYKFD PWVLPEKAEF  60
GDNEWYFFTP RDRKYPNGVR PNRAAVSGYW KATGTDKAIY SANKYVGIKK ALVFYKGKPP  120
KGVKTDWIMH EYRLSDSKSQ TSKQSGSMRL DDWVLCRIYK KKNLGRTIEM MKVEEEELEA  180
QNVSTTNNEI EVVGGPQTMK LPRICSLSHL LELDYFGSIP QLLSDNLLYD DQGYTMNNVN  240
NTSNVDQVSS QQQNTNNITS NNCNIFFNYQ QPLFVNPTFQ SQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A6e-72816314170Stress-induced transcription factor NAC1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.190170.0callus| cell culture| flower| fruit| root
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots, stem, flowers, and leaves. {ECO:0000269|PubMed:29760199}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds DNA motifs 5'-CGT[AG](5N)NACG[ACT][AC][AT][ACG][ACT]-3' and 5'-CACG[ACT][AC][AT][AGT][CT]-3' in target genes promoters. Promotes leaf senescence and reduces fruit yield and sugar content, probably by establishing abscisic acid (ABA) homeostasis. {ECO:0000269|PubMed:29760199}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc05g007770.2.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Accumulates during age-dependent and dark-induced leaf senescence. {ECO:0000269|PubMed:29760199}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2327630.0Solanum lycopersicum cv. Heinz 1706, chromosome 5 BAC clone C05SLm0084G04, complete sequence
GenBankAC2387430.0Solanum lycopersicum chromosome 05 clone C05HBa0099K13, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001316452.10.0NAC domain-containing protein 1
SwissprotK4BWV20.0NAP1_SOLLC; NAC domain-containing protein 1
TrEMBLM1BKS30.0M1BKS3_SOLTU; Uncharacterized protein
STRINGSolyc05g007770.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA74624103
Representative plantOGRP1715800
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69490.11e-109NAC-like, activated by AP3/PI
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]
  2. Tomato Genome Consortium
    The tomato genome sequence provides insights into fleshy fruit evolution.
    Nature, 2012. 485(7400): p. 635-41
    [PMID:22660326]
  3. Ma X, et al.
    The NAC Transcription Factor SlNAP2 Regulates Leaf Senescence and Fruit Yield in Tomato.
    Plant Physiol., 2018. 177(3): p. 1286-1302
    [PMID:29760199]