PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc05g007100.2.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family Whirly
Protein Properties Length: 269aa    MW: 29533.4 Da    PI: 9.484
Description Whirly family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc05g007100.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Whirly216.23.2e-67912291139
              Whirly   1 svyktkaalkvkavrptfealdsgnlklkraGglllelanataerkydWekkqsfalsatevaelvdlaskesceffhdpaakgsneGkvr 91 
                         s+yk+kaal+v+++ p+f+ ldsg++kl+++G ++l++a+a+++r+ydW++kq+f+ls+te++++++l++k+sceffhdp ++ s+eG+vr
  Solyc05g007100.2.1  91 SIYKGKAALTVEPRSPEFSPLDSGAFKLSKEGMVMLQFAPAAGVRQYDWSRKQVFSLSVTEIGSIISLGAKDSCEFFHDPNKGRSDEGRVR 181
                         7****************************************************************************************** PP

              Whirly  92 kalkvePlpdGsGlfvnlsvtnslvkgnesfsvPvskaefavlrsllv 139
                         k+lkvePlpdGsG+f+nlsv+n+l++ +e++++Pv+kaefavl s+++
  Solyc05g007100.2.1 182 KVLKVEPLPDGSGHFFNLSVQNKLINLDENIYIPVTKAEFAVLVSAFN 229
                         ********************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.30.31.103.2E-7979251IPR009044ssDNA-binding transcriptional regulator
SuperFamilySSF544473.84E-8284268IPR009044ssDNA-binding transcriptional regulator
PfamPF085363.7E-6292226IPR013742Plant transcription factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006281Biological ProcessDNA repair
GO:0032211Biological Processnegative regulation of telomere maintenance via telomerase
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0045910Biological Processnegative regulation of DNA recombination
GO:0009508Cellular Componentplastid chromosome
GO:0009570Cellular Componentchloroplast stroma
GO:0003697Molecular Functionsingle-stranded DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0003723Molecular FunctionRNA binding
GO:0042162Molecular Functiontelomeric DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 269 aa     Download sequence    Send to blast
MSVFSLSASP ASGFSLNPTK TSSYLSFSSS INTIFAPLTS NTTKSFSGLT YKAALPRNLS  60
LTCRHSDYFE PQQQQQQLQG ASTPKVFVGY SIYKGKAALT VEPRSPEFSP LDSGAFKLSK  120
EGMVMLQFAP AAGVRQYDWS RKQVFSLSVT EIGSIISLGA KDSCEFFHDP NKGRSDEGRV  180
RKVLKVEPLP DGSGHFFNLS VQNKLINLDE NIYIPVTKAE FAVLVSAFNF VMPYLLGWHT  240
AVNSFKPEDA SRSNNTNPRS GAELEWNR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1l3a_A1e-1396426712219p24: plant transcriptional regulator PBF-2
1l3a_B1e-1396426712219p24: plant transcriptional regulator PBF-2
1l3a_C1e-1396426712219p24: plant transcriptional regulator PBF-2
1l3a_D1e-1396426712219p24: plant transcriptional regulator PBF-2
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.132950.0cell culture| flower| fruit
Functional Description ? help Back to Top
Source Description
UniProtSingle-stranded DNA-binding protein that acts as a transcriptional activator of the pathogenesis-related gene PR-10a. Upon elicitation, binds a 30bp promoter sequence known as elicitor element response (ERE) and is required for PR-10a expression. {ECO:0000269|PubMed:10948264, ECO:0000269|PubMed:12080340, ECO:0000269|PubMed:14960277}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc05g007100.2.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1946941e-132Solanum lycopersicum cv. Heinz 1706, chromosome 5 BAC clone C05HBa0058L13, complete sequence
GenBankAC2123011e-132Solanum lycopersicum cv. Heinz 1706, chromosome 5 BAC clone C05HBa0060G21, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001289829.20.0DNA-binding protein WHY1
SwissprotQ9LL851e-180WHY1_SOLTU; Single-stranded DNA-binding protein WHY1, chloroplastic
TrEMBLA0A3Q7GDE70.0A0A3Q7GDE7_SOLLC; Uncharacterized protein
STRINGSolyc05g007100.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA77312430
Representative plantOGRP23161635
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14410.11e-110ssDNA-binding transcriptional regulator
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]