PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc04g082890.2.1
Common NameLOC101245758
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family bZIP
Protein Properties Length: 285aa    MW: 32220.3 Da    PI: 5.9521
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc04g082890.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_123.51.2e-07123164445
                         XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaL 45 
                         +k+ +r  +NR AA rsR+RKk ++  Le k+  +e+e k+L
  Solyc04g082890.2.1 123 DKKRKRQLRNRDAAVRSRERKKLYVRDLELKSRYFESECKRL 164
                         799**********************************99887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.3E-4120184IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1703.7E-10121183No hitNo description
PROSITE profilePS502179.358122164IPR004827Basic-leucine zipper domain
PfamPF077166.8E-5123164IPR004827Basic-leucine zipper domain
SuperFamilySSF579595.31E-10124182No hitNo description
CDDcd147042.26E-14125176No hitNo description
PROSITE patternPS000360127142IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010200Biological Processresponse to chitin
GO:0030968Biological Processendoplasmic reticulum unfolded protein response
GO:0005634Cellular Componentnucleus
GO:0005789Cellular Componentendoplasmic reticulum membrane
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 285 aa     Download sequence    Send to blast
MIDNIDDIIN WDDVDHIFHN VLDNPDDDQF TLHDSSPQSF QQIEQLLMND DDFGLVSDPQ  60
FAAESLSDFL VDSPLHSDHS HSPAEQAIGF SDPKVSSADQ DKHKVSQSPS DGDDELNNHD  120
PVDKKRKRQL RNRDAAVRSR ERKKLYVRDL ELKSRYFESE CKRLGFVLQC CLAENQALRF  180
SLHNSSANGV SMTKQESAVL FLESLLLGSL LWFLGITCLL ILPSQTWSVP EESQGSRNHG  240
LLVPIKEGKK TSRILLFLSF MMSKRCKASR SRMKLNPHPL GVVM*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1124143KRKRQLRNRDAAVRSRERKK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.142990.0callus| flower| fruit| leaf| root| stem| trichome
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00019PBMTransfer from AT1G42990Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc04g082890.2.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCU1796340.0S.lycopersicum DNA sequence from clone SL_MboI-59M16 on chromosome 4, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004238469.10.0bZIP transcription factor 60
TrEMBLA0A3Q7G8U70.0A0A3Q7G8U7_SOLLC; Uncharacterized protein
STRINGSolyc04g082890.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA71012128
Representative plantOGRP54681518
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G42990.12e-18basic region/leucine zipper motif 60
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]