PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc04g082480.2.1
Common NameLOC101260431
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family Nin-like
Protein Properties Length: 913aa    MW: 102468 Da    PI: 5.6947
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc04g082480.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK94.38.2e-30588639152
              RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                         aek+i+l++l++yF++++kdAAk++gvc+T+LKriCRq+GIkRWP+Rkik++
  Solyc04g082480.2.1 588 AEKTITLQVLQQYFAGSLKDAAKSIGVCPTTLKRICRQHGIKRWPSRKIKKV 639
                         589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.518578659IPR003035RWP-RK domain
PfamPF020421.1E-25591639IPR003035RWP-RK domain
SuperFamilySSF542772.23E-23803896No hitNo description
PROSITE profilePS5174524.928811895IPR000270PB1 domain
SMARTSM006669.2E-24811894IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2402.2E-21812890No hitNo description
CDDcd064072.37E-39813894No hitNo description
PfamPF005641.8E-18813893IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 913 aa     Download sequence    Send to blast
MDERVIPSNP LLTTPSDYLM DLDYMDGLFL EGCWLETTDG NEFLQHSPGI FNAPFDSSFM  60
WPTTIDANNV EFNGISSKDA QQEKQRPSLT ENLSINHCQE LNYAKVQSFG ENMNNAMCTS  120
SLSENHLVEA HELNKRWWIG PKASSSVMDR LIWALGYIRD CSRDKDILLQ LWVPINRDGR  180
RVLSTTNQPF LLDLNCPQLA NYREVSVNYQ FPANEDSKEI VGLPGRVFAD KVPEWTPDVR  240
FFRSEEYPRV EHAQQYDVRG TLAVPVFEQG SRNCLGVIEV VMTTQKIKYR SELESVCKAL  300
EAVDLSTSEV STTQDAKVCD LSYQAALPEV LEVLKSACET HGLPLAQTWV PCIQQGKGGC  360
RHSQENLIHC VSTEDSACYV ADPRVQGFHD ACSEHHLLKG QGVVGRAFNT NQPCFSADLT  420
SYSKSEYPLS HYAKMFGLQA AVAIRLRSIS TGSSDFVLEF FLPSDCRNPE DHRKMLTSLS  480
IIIQNVCRTL RVVTDKELQE ETISVGEMAN HTVEQHKEHT ETSQERTSWT SCDAEFQESS  540
VMSTFQDEKP DEMLRKDSVE FRHRKNSAYE EGVSRNLGKT GDRRRAKAEK TITLQVLQQY  600
FAGSLKDAAK SIGVCPTTLK RICRQHGIKR WPSRKIKKVG HSLQKIQRVI DSVQGASGTL  660
QIESFYSNFP ELASPNASRM SPFADSKSNE HPTALNTQQE RCITSPNPDA SKSPSSSSSR  720
SSSSSQCCSS GTKPQSPQSH PLSIVGDEDL IVQEESVDNA VKRVKSEPEL HLSSEALKTI  780
PRSQSHLCVA ENPISENLVL KRSPSTSQEE APRVKVTHGE EKIRFRMQNS WRYNDLLREI  840
TRRFGIDDPS GLQLKYLDDD SEWVLLTCDA DLEECIDVCM SSQIQMIKLI LVQDSQHHFG  900
SSFGSSSPIL VQ*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.81860.0callus| flower
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00154DAPTransfer from AT1G20640Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc04g082480.2.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCU3263790.0S.lycopersicum DNA sequence from clone LE_HBa-68N5 on chromosome 4, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004238434.10.0protein NLP4 isoform X1
RefseqXP_010320461.10.0protein NLP4 isoform X1
RefseqXP_010320463.10.0protein NLP4 isoform X1
SwissprotQ9LE380.0NLP4_ARATH; Protein NLP4
TrEMBLA0A3Q7GB400.0A0A3Q7GB40_SOLLC; Uncharacterized protein
STRINGSolyc04g082480.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA15982467
Representative plantOGRP2991697
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76350.10.0Nin-like family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]