PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc04g081190.2.1
Common Namevsf-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family bZIP
Protein Properties Length: 445aa    MW: 48278.1 Da    PI: 9.5749
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc04g081190.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_131.92.9e-10299350556
                         CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkev 56 
                         kr++r   NR++A rs +RK  +i eLe kv++L++e ++L  ++  l+k+ 
  Solyc04g081190.2.1 299 KRAKRILANRLSAARSKERKTRYISELEHKVQKLQTETTTLSTQVTILQKNF 350
                         9*****************************************9998888865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.1E-13295359IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.875297360IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.53E-11299353No hitNo description
PfamPF001702.5E-9299350IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.0E-11299351No hitNo description
CDDcd147031.50E-19300349No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 445 aa     Download sequence    Send to blast
MAQSNSKPPM SSQNFGVGAV SHVRSLSQSS IFSNSCLPPL SPFPPSEPGM VSGHSSLKDI  60
SMEEADVNSQ GVGVVSSFTR DGLPPRKGHR RSNSDVPLGF SAMIQSSPQL MPISGQKVLG  120
RAVSLGDSNG KIDERKPKGE VTDELLFSYM NLENIETLNG SGTKDRDKDS IVSGTKVTGS  180
ESSNNEAESV MKGNNVSIQP TNLREGTKRS ADANIAPAAR HFRSLSMDSA IGNFHYGDES  240
PNLPTSLMMR SGQLSPSNSG NESSSKHNLD FGNSEFSEAE MKKIMADERL AEIAVLDPKR  300
AKRILANRLS AARSKERKTR YISELEHKVQ KLQTETTTLS TQVTILQKNF VEISSLNSEL  360
KFRIQAMEQQ AQLRDALHEA LTAEVQRLKL AAGEHREEGR LPNNMTQQTP VKHNIFQMQR  420
QQPSQMQQLS VGKASAASAT PASA*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.36430.0flower| fruit| leaf
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc04g081190.2.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankX736350.0L.esculentum vsf-1 mRNA
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001234548.20.0transcription factor VSF-1
TrEMBLO819980.0O81998_SOLLC; Transcription factor VSF-1
STRINGSolyc04g081190.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12652478
Representative plantOGRP12617181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G21230.15e-74bZIP family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]
  2. Torres-Schumann S,Ringli C,Heierli D,Amrhein N,Keller B
    In vitro binding of the tomato bZIP transcriptional activator VSF-1 to a regulatory element that controls xylem-specific gene expression.
    Plant J., 1996. 9(3): p. 283-96
    [PMID:8919907]
  3. Ringli C,Keller B
    Specific interaction of the tomato bZIP transcription factor VSF-1 with a non-palindromic DNA sequence that controls vascular gene expression.
    Plant Mol. Biol., 1998. 37(6): p. 977-88
    [PMID:9700070]