PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc04g079830.2.1
Common NameLOC101247316
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family TALE
Protein Properties Length: 693aa    MW: 77998.9 Da    PI: 6.9707
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc04g079830.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.21.5e-094925291954
                         HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
            Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                         Fe   ++yps++++  L++++gL+++qV++WF N R +
  Solyc04g079830.2.1 492 FEHflHPYPSEADKHLLSRQTGLSKNQVSNWFINARVR 529
                         554459******************************88 PP

2BELL111.45e-36352423172
                BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                         er e q++k kLls+l+eVd rY +y+eq+q++++sF+ v+g+g+a+pYt+lA+ka+SrhFrc+kdai++q+
  Solyc04g079830.2.1 352 ERSEYQRRKIKLLSMLDEVDARYTRYCEQMQAMVNSFDSVIGYGAAAPYTALAQKAMSRHFRCIKDAIVGQL 423
                         789******************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.2E-55284421IPR006563POX domain
PfamPF075261.6E-48290420IPR006563POX domain
PROSITE profilePS5007112.422470533IPR001356Homeobox domain
CDDcd000861.04E-11473534No hitNo description
SMARTSM003891.8E-9473537IPR001356Homeobox domain
SuperFamilySSF466896.84E-17474540IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.6E-28476539IPR009057Homeodomain-like
PfamPF059207.6E-18490529IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 693 aa     Download sequence    Send to blast
MSHSFHQQQG FYNFSNVYER SATTTTKHED MLRVQGFEPQ QVEVAAADVE PPPTATVYDD  60
GGMLTEIISY PSAWRKTATE ILDDQIQSSN YRSWPQKEQQ HLQQQQQQLL PQSIINDTEL  120
PLMNPHIKPS SPPRSSSSLH MLLPNSVDTN NLLHHQGFHL LNPAPVETPS QFTWIPGSSS  180
GEDNSARIGR VVDGQGLSLS LSRNFEAAAK LEDLRIGNGE IYLHNNQGLL GPINNNNHHH  240
HHHQLLHSGV IMDHRTPPHP HPLPPHSSTG HHHQIHVGYA ASSPRISNAL RNSRYVKATQ  300
ELLEEFCCVG RGNFKNQRVK KLDDDQNPNS NSESEDHRGP SKDNHPPLSA AERSEYQRRK  360
IKLLSMLDEV DARYTRYCEQ MQAMVNSFDS VIGYGAAAPY TALAQKAMSR HFRCIKDAIV  420
GQLKQTCKYL GEKDVTGTSG LTKGETPRLK MLDQKLRQQK ALHQMGMLDS DAWRPQRGLP  480
ERSVNVLRAW LFEHFLHPYP SEADKHLLSR QTGLSKNQVS NWFINARVRL WKPMVEEMYQ  540
QETKEAETDQ EEEEQEQQQQ EKQAQIPMHN MATSPAAATT KTTTMSLSSS VRSKLNANER  600
DPSENIINYR QYALGNQLVM LQSDDTTTAS TSTHHYFTAV NAVDLVADPN AVNTAAFGSQ  660
QAGDVSLTLG LRHSENVPRK PAQFQLRDFG AY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A2e-16479537563Homeobox protein Meis2
3k2a_B2e-16479537563Homeobox protein Meis2
4xrm_A2e-16479537563Homeobox protein Meis2
4xrm_B2e-16479537563Homeobox protein Meis2
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.174190.0flower| leaf
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCU4590250.0S.lycopersicum DNA sequence from clone LE_HBa-223O22 on chromosome 4, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004238216.10.0PREDICTED: BEL1-like homeodomain protein 4
TrEMBLK4BV620.0K4BV62_SOLLC; Uncharacterized protein
STRINGSolyc04g079830.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP13316172
AsteridsOGEA60721721
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36870.21e-124BEL1-like homeodomain 2
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]