PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc04g079570.1.1
Common NameLOC101264214
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family Dof
Protein Properties Length: 240aa    MW: 24387.9 Da    PI: 6.8879
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc04g079570.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.14.5e-392583361
              zf-Dof  3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                         ++l+cprCdstntkfCyynny+lsqPr+fCk+CrryWt+GG+lrnvPvGgg+rkn ++
  Solyc04g079570.1.1 25 PENLPCPRCDSTNTKFCYYNNYNLSQPRHFCKSCRRYWTRGGTLRNVPVGGGTRKNSSH 83
                        57899**************************************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074786.0E-252482IPR003851Zinc finger, Dof-type
PfamPF027012.8E-332782IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.5532882IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103066IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 240 aa     Download sequence    Send to blast
MSSEIGDRRP ARLPAPVNGT RPSEPENLPC PRCDSTNTKF CYYNNYNLSQ PRHFCKSCRR  60
YWTRGGTLRN VPVGGGTRKN SSHKRPRINS GAGTVQEQTN PITMMGSGSG HVSGSGSMSL  120
MGCEVNLNES VHEGGNGTSS FTSLLTAPVG VGVGGFVPLG GFGLGLGGFG LGNLDWPMEQ  180
VSGGGNGGDG GENDKWQLSG GEMEGGGGGG GSGGGGIGGD DDCFGWPDLA ISAPGTSLK*
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc04g079570.1.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCU9145240.0S.lycopersicum DNA sequence from clone LE_HBa-107D6 on chromosome 4, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004238591.11e-170dof zinc finger protein DOF3.4-like
TrEMBLA0A3Q7H2F71e-169A0A3Q7H2F7_SOLLC; Uncharacterized protein
STRINGSolyc04g079570.1.11e-169(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8824419
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G50410.16e-34OBF binding protein 1
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]