PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc04g078840.2.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family bZIP
Protein Properties Length: 448aa    MW: 47977.7 Da    PI: 9.947
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc04g078840.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_148.61.8e-15369419555
                         CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55 
                         +r+rr++kNRe+A rsR+RK+a++ eLe +v++L++eN++L+k+ ee+ ++
  Solyc04g078840.2.1 369 RRQRRMIKNRESAARSRARKQAYTMELEAEVAKLKEENDELQKKQEEMLEM 419
                         79***************************************9888776555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003386.1E-14365430IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.45367416IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1705.7E-15369418No hitNo description
CDDcd147074.57E-30369423No hitNo description
SuperFamilySSF579592.18E-11369418No hitNo description
PfamPF001709.0E-13369419IPR004827Basic-leucine zipper domain
PROSITE patternPS000360372387IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0009738Biological Processabscisic acid-activated signaling pathway
GO:0010255Biological Processglucose mediated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0000976Molecular Functiontranscription regulatory region sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 448 aa     Download sequence    Send to blast
MGSNYHFKNF GNEPPGEGGS GGGGKQPGNF GLPRQPSIYS LTFDEFLSST GGSGKDFGSM  60
NMDELLKNIW NAEENQTIGG PGINGQEVGV PGGHLQRQGS LTLPRTLSHK TVDEVWRDMS  120
KEHGGGKDGN SVGVPPNIPQ TQRQQNLGEI TLEEFLVRAG VVREDAQFAA KSNNAGGIFG  180
DLSYAGNNTG LAFGYHQANS RNTGLMAGSI PNKNGETVIQ SANLPLNVNG VRSTQQQLRP  240
QQLQQNQQSQ PQQQPIFPKQ PALPYGAPMA IPNSGQLGSP GMRAGMVGIP DPALNSNFIQ  300
GASLMGGGMN MVGLGASGVT VATASPGVSS SDGLGKSNGD TPSVSPVPYV FNGGLRGRKY  360
STVEKVVERR QRRMIKNRES AARSRARKQA YTMELEAEVA KLKEENDELQ KKQEEMLEMQ  420
KNQVIEMMNL QKGAKRRCLR RTQTGPW*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.45240.0fruit| leaf
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots, leaves, flowers and siliques but not in seeds. {ECO:0000269|PubMed:11005831, ECO:0000269|PubMed:15361142, ECO:0000269|PubMed:16284313}.
Functional Description ? help Back to Top
Source Description
UniProtInvolved in ABA and stress responses and acts as a positive component of glucose signal transduction. Functions as transcriptional activator in the ABA-inducible expression of rd29B. Binds specifically to the ABA-responsive element (ABRE) of the rd29B gene promoter. {ECO:0000269|PubMed:11005831, ECO:0000269|PubMed:15361142, ECO:0000269|PubMed:16284313, ECO:0000269|PubMed:16463099}.
Function -- GeneRIF ? help Back to Top
  1. AREB1 is a bZIP transcription factor induced by different stresses. It can regulate transcription of genes associated with drought tolerance. [AREB1]
    [PMID: 19652975]
  2. these results show that SlAREB functions to regulate some stress-responsive genes and that its overproduction improves plant tolerance to water deficit and salt stress. [SlAREB]
    [PMID: 20358223]
  3. SlAREB1 is a bZIP transcription factor that is involved in abscisic acid signals that participate in abiotic stress and possibly in response to pathogens
    [PMID: 20807374]
  4. Transcription factors SlAREB1 and SlAREB2 are expressed in different tissues and during fruit development. Expression of SlAREB1 affects ABA sensitivity of transgenic seeds.
    [PMID: 21128945]
  5. AREB1 regulates primary metabolic pathways in tomato fruits.
    [PMID: 24659489]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00186DAPTransfer from AT1G45249Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc04g078840.2.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated by drought, salt, abscisic acid (ABA), cold and glucose. {ECO:0000269|PubMed:10636868, ECO:0000269|PubMed:11005831, ECO:0000269|PubMed:15361142, ECO:0000269|PubMed:16284313, ECO:0000269|PubMed:16463099}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5307580.0Lycopersicon esculentum AREB-like protein mRNA, complete cds
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001234596.10.0ABA-response element binding factor AREB1
RefseqXP_010320059.10.0AREB-like protein isoform X1
RefseqXP_025886215.10.0AREB-like protein isoform X1
SwissprotQ9M7Q41e-130AI5L5_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 5
TrEMBLQ6QPK10.0Q6QPK1_SOLLC; AREB
STRINGSolyc04g078840.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA7762497
Representative plantOGRP39841024
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G45249.11e-113abscisic acid responsive elements-binding factor 2
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]
  2. Y
    An abiotic stress-responsive bZIP transcription factor from wild and cultivated tomatoes regulates stress-related genes.
    Plant Cell Rep., 2009. 28(10): p. 1497-507
    [PMID:19652975]
  3. Hsieh TH, et al.
    A tomato bZIP transcription factor, SlAREB, is involved in water deficit and salt stress response.
    Planta, 2010. 231(6): p. 1459-73
    [PMID:20358223]
  4. Orellana S, et al.
    The transcription factor SlAREB1 confers drought, salt stress tolerance and regulates biotic and abiotic stress-related genes in tomato.
    Plant Cell Environ., 2010. 33(12): p. 2191-208
    [PMID:20807374]
  5. Bast
    Modulation of organic acids and sugar content in tomato fruits by an abscisic acid-regulated transcription factor.
    Physiol Plant, 2011. 141(3): p. 215-26
    [PMID:21128945]
  6. Bast
    The transcription factor AREB1 regulates primary metabolic pathways in tomato fruits.
    J. Exp. Bot., 2014. 65(9): p. 2351-63
    [PMID:24659489]
  7. Gao S, et al.
    ABF2, ABF3, and ABF4 Promote ABA-Mediated Chlorophyll Degradation and Leaf Senescence by Transcriptional Activation of Chlorophyll Catabolic Genes and Senescence-Associated Genes in Arabidopsis.
    Mol Plant, 2016. 9(9): p. 1272-1285
    [PMID:27373216]
  8. Seok HY, et al.
    Arabidopsis AtNAP functions as a negative regulator via repression of AREB1 in salt stress response.
    Planta, 2017. 245(2): p. 329-341
    [PMID:27770200]