PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc04g078650.2.1
Common NameLOC100301933
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family WOX
Protein Properties Length: 243aa    MW: 27686.1 Da    PI: 8.7775
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc04g078650.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox67.41.8e-2197156357
                         --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
            Homeobox   3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                         +R+++t+eq+ +Le l++   r+p+a+++e+++++l    +++ ++V++WFqN++a+e++
  Solyc04g078650.2.1  97 TRWNPTQEQIGILEMLYRGgMRTPNAQQIEQITAQLgkygKIEGKNVFYWFQNHKARERQ 156
                         7*****************99**************************************97 PP

2Wus_type_Homeobox118.33.5e-3897158465
   Wus_type_Homeobox   4 tRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                         tRW+Pt+eQi iLe+ly+ G+rtPn+++i++ita+L +yGkie+kNVfyWFQN+kaRerqkq
  Solyc04g078650.2.1  97 TRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARERQKQ 158
                         8***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466898.98E-1392162IPR009057Homeodomain-like
PROSITE profilePS5007110.28492157IPR001356Homeobox domain
SMARTSM003891.2E-794161IPR001356Homeobox domain
CDDcd000862.58E-597158No hitNo description
PfamPF000463.6E-1997156IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.605.4E-898156IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001944Biological Processvasculature development
GO:0007165Biological Processsignal transduction
GO:0010067Biological Processprocambium histogenesis
GO:0051301Biological Processcell division
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000017anatomyvascular leaf primordium
PO:0006339anatomyjuvenile vascular leaf
PO:0009046anatomyflower
PO:0020100anatomyhypocotyl
Sequence ? help Back to Top
Protein Sequence    Length: 243 aa     Download sequence    Send to blast
MYMGSSSGSL SMKVHQFTRG FLEHEAASPS LTLGCKRLRP LAPKLNTTNN DTTTTIVTPP  60
FDLKSFIRPE SSNSPPKLAY NEDKKDSSQV ESHPGGTRWN PTQEQIGILE MLYRGGMRTP  120
NAQQIEQITA QLGKYGKIEG KNVFYWFQNH KARERQKQKR NSLGLSQSPR TPSAIVTSPL  180
SFDTRGEVVR DEDSPYKRKC RGWTFEYMEE EQQQQDEEEI INCRENGDRT LQLFPLHPEG  240
MR*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.63280.0cell culture| stem
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor which may be involved in developmental processes. {ECO:0000250}.
Function -- GeneRIF ? help Back to Top
  1. Overexpression of WOX4 in tomato confers a hypervascularization phenotype.
    [PMID: 20044450]
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc04g078650.2.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ4408490.0Solanum lycopersicum WOX4 mRNA, complete cds
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001234251.10.0WOX4
SwissprotQ6X7J93e-75WOX4_ARATH; WUSCHEL-related homeobox 4
TrEMBLB7U6X30.0B7U6X3_SOLLC; WOX4
STRINGSolyc04g078650.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA61862335
Representative plantOGRP71671117
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G46480.17e-74WUSCHEL related homeobox 4
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]
  2. Ji J, et al.
    WOX4 promotes procambial development.
    Plant Physiol., 2010. 152(3): p. 1346-56
    [PMID:20044450]
  3. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  4. Dolzblasz A, et al.
    Stem Cell Regulation by Arabidopsis WOX Genes.
    Mol Plant, 2016. 9(7): p. 1028-39
    [PMID:27109605]
  5. Guo X, et al.
    Identification of cyst nematode B-type CLE peptides and modulation of the vascular stem cell pathway for feeding cell formation.
    PLoS Pathog., 2017. 13(2): p. e1006142
    [PMID:28158306]
  6. Denis E, et al.
    WOX14 promotes bioactive gibberellin synthesis and vascular cell differentiation in Arabidopsis.
    Plant J., 2017. 90(3): p. 560-572
    [PMID:28218997]
  7. Kucukoglu M,Nilsson J,Zheng B,Chaabouni S,Nilsson O
    WUSCHEL-RELATED HOMEOBOX4 (WOX4)-like genes regulate cambial cell division activity and secondary growth in Populus trees.
    New Phytol., 2017. 215(2): p. 642-657
    [PMID:28609015]
  8. Yamaguchi YL, et al.
    Root-Knot and Cyst Nematodes Activate Procambium-Associated Genes in Arabidopsis Roots.
    Front Plant Sci, 2017. 8: p. 1195
    [PMID:28747918]