PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc04g077510.2.1
Common NameLOC101252681
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family GRF
Protein Properties Length: 596aa    MW: 64111.8 Da    PI: 8.2262
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc04g077510.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC77.11.7e-24204248145
                 WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                         d+epgrCrRtDGKkWRCsr++++++k+CErH++rgr+rsrk++e 
  Solyc04g077510.2.1 204 DPEPGRCRRTDGKKWRCSRDAVADQKYCERHMNRGRHRSRKPVEG 248
                         79****************************************985 PP

2QLQ60.16.2e-21136172137
                 QLQ   1 saFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                         ++FT++Q+++L++Q+l+yKy+ an P+Pp+Ll +i+k
  Solyc04g077510.2.1 136 GPFTPSQWMELEHQALIYKYITANIPIPPYLLNPIRK 172
                         59*********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009515.7E-12136172IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166624.118137172IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088802.0E-15137171IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.663204248IPR014977WRC domain
PfamPF088797.1E-21205247IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009624Biological Processresponse to nematode
GO:0048364Biological Processroot development
GO:0048366Biological Processleaf development
GO:0061062Biological Processregulation of nematode larval development
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 596 aa     Download sequence    Send to blast
MDFGGLDSGG GGVICSDNTT MFVASAETKQ KWYGSGGFNK HERSSVTEDE WNKESKLAKT  60
SDDFSSTKAT MMFHQLPISH DNQQMLSFSA PNSQNHVTMP YYNQHPSTAF ARNTSGYGSG  120
ALNAGNMHGL IAGIKGPFTP SQWMELEHQA LIYKYITANI PIPPYLLNPI RKALESAGFS  180
TFAGLRPNAL GWGAFHLGFS NSNDPEPGRC RRTDGKKWRC SRDAVADQKY CERHMNRGRH  240
RSRKPVEGQT GNSASGNNTG VTTTSAKLTN MPSAASAALA SGGGAAASNS LNLSHHNQLS  300
NLQPAGTNLS TTSPYLERSY TAKENFGERY SDTKGSSVVS ASVKEPQYSI QKAQNLYGLT  360
SRAEFGLVCA DSLINPLNKN SSLVNCRGYV NSDVSDQESK SQHHPLRQFM DEWPKNQSDQ  420
SNVSWPDIDL QSDPTQLSIS IPLVTSDFMS STSSPANDKL TASPRRSREH EATQMGLGIG  480
TIISEHNQRQ GSWIPISWES SLGGPLGEVL HSTNSSSGDC KNKSALNLLT EGWDRSPRMG  540
SSPTGVLQKS SFGSLSNSSA GSSPRAEHSK TTNEGSSLCN GLLGTTLMNP TLPAM*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.130770.0flower| fruit| leaf| root
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc04g077510.2.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004238069.10.0growth-regulating factor 1-like isoform X2
TrEMBLA0A3Q7G8H80.0A0A3Q7G8H8_SOLLC; Uncharacterized protein
STRINGSolyc04g077510.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA16882357
Representative plantOGRP33571226
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22840.13e-91growth-regulating factor 1
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]