PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc04g074990.2.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family ZF-HD
Protein Properties Length: 144aa    MW: 16096.9 Da    PI: 6.3889
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc04g074990.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer107.67.4e-3444100259
         ZF-HD_dimer   2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59 
                         ++vrY+eClkNhA+ +Ggha+DGCgEfmp+ geegt++alkCaAC+CHRnFHR+e ee
  Solyc04g074990.2.1  44 SNVRYRECLKNHAVGIGGHALDGCGEFMPA-GEEGTMDALKCAACNCHRNFHRKEAEE 100
                         689**************************9.999********************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047701.5E-304598IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257742.0E-234799IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015665.7E-314797IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.9984897IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene3DG3DSA:1.10.10.609.4E-1897142IPR009057Homeodomain-like
SuperFamilySSF466897.17E-999141IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 144 aa     Download sequence    Send to blast
MEFDDDQEEQ EQEIGAVGAE NYVTTGNNSG REEGISTSSI GRKSNVRYRE CLKNHAVGIG  60
GHALDGCGEF MPAGEEGTMD ALKCAACNCH RNFHRKEAEE RLGWRMQKQD EALVQQFCAE  120
TNVKRHVFKV WMHNNKHTLG KKP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A8e-141001383775ZF-HD homeobox family protein
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.210231e-168floral bud| flower| leaf
Les.30421e-168flower| leaf
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc04g074990.2.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCU9281321e-128S.lycopersicum DNA sequence from clone SL_MboI-49I21 on chromosome 4, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004237971.18e-58zinc-finger homeodomain protein 2
SwissprotQ6YXH51e-29ZHD1_ORYSJ; Zinc-finger homeodomain protein 1
TrEMBLA0A3Q7H0I31e-103A0A3Q7H0I3_SOLLC; Uncharacterized protein
STRINGSolyc04g074990.2.11e-104(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA2027933
Representative plantOGRP9116237
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24660.13e-30homeobox protein 22
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]