PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc04g072460.2.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family bZIP
Protein Properties Length: 362aa    MW: 40880.5 Da    PI: 7.2366
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc04g072460.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_134.54.6e-1177107333
                         XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLee 33 
                         ++k++rr+++NReAAr+sR RKka++++Le+
  Solyc04g072460.2.1  77 SDKVQRRLAQNREAARKSRMRKKAYVQQLET 107
                         79***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003386.2E-675135IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1706.3E-1075119No hitNo description
PROSITE profilePS502179.00277121IPR004827Basic-leucine zipper domain
PfamPF001701.1E-777109IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.81E-779114No hitNo description
PROSITE patternPS0003608297IPR004827Basic-leucine zipper domain
PfamPF141442.2E-28165238IPR025422Transcription factor TGA like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 362 aa     Download sequence    Send to blast
MTSPTTQFAP TRRMGIYEPF HQMSVWEDAF RGDIMPSADA CMVSHPNDRP DDKSGYTSGE  60
QHMPSGSGDN QGPRSSSDKV QRRLAQNREA ARKSRMRKKA YVQQLETSRL KLAQLELELE  120
RARQQGLYML GSNSNMGLLG TINPGIAAFE IEYSHWVEEQ QKKNAELRSI LQSPVSDMEL  180
QLLVENVLSH YFNLFRMKAD AAKADVFYLM SGVWRTSVER FFLWIGGFKP SELINVVMPQ  240
LEPLADQQII KVCNLRHCCQ QAEDALTQGM DKLQQTLAQS ILNMNTGAGN YTSQMVSSME  300
NLEALESFVN QADHLRQQTL QQMSIILTTH QAARGLLAFG EYVQRLRALS SLWAARPREP  360
T*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.55910.0flower| fruit
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Predominantly expressed in roots. {ECO:0000269|PubMed:8628224}.
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specifically to the DNA sequence 5'-TGACG-3'. Recognizes ocs elements like the as-1 motif of the cauliflower mosaic virus 35S promoter. Binding to the as-1-like cis elements mediate auxin- and salicylic acid-inducible transcription. May be involved in the induction of the systemic acquired resistance (SAR) via its interaction with NPR1. Could also bind to the Hex-motif (5'-TGACGTGG-3') another cis-acting element found in plant histone promoters.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc04g072460.2.1
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0142160.0Lycopersicon esculentum clone 133394F, mRNA sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004237865.10.0transcription factor TGA1 isoform X2
RefseqXP_010320138.10.0transcription factor TGA4 isoform X1
RefseqXP_010320139.10.0transcription factor TGA1 isoform X2
SwissprotQ392371e-152TGA1_ARATH; Transcription factor TGA1
TrEMBLA0A3Q7G6X70.0A0A3Q7G6X7_SOLLC; Uncharacterized protein
STRINGSolyc04g072460.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA7802497
Representative plantOGRP26791132
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65210.51e-141bZIP family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]
  2. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  3. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  4. Herrera-Vásquez A, et al.
    Transcriptional Control of Glutaredoxin GRXC9 Expression by a Salicylic Acid-Dependent and NPR1-Independent Pathway in Arabidopsis.
    Plant Mol. Biol. Rep., 2018.
    [PMID:26696694]
  5. Gutsche N,Zachgo S
    The N-Terminus of the Floral Arabidopsis TGA Transcription Factor PERIANTHIA Mediates Redox-Sensitive DNA-Binding.
    PLoS ONE, 2016. 11(4): p. e0153810
    [PMID:27128442]
  6. Sun T, et al.
    TGACG-BINDING FACTOR 1 (TGA1) and TGA4 regulate salicylic acid and pipecolic acid biosynthesis by modulating the expression of SYSTEMIC ACQUIRED RESISTANCE DEFICIENT 1 (SARD1) and CALMODULIN-BINDING PROTEIN 60g (CBP60g).
    New Phytol., 2018. 217(1): p. 344-354
    [PMID:28898429]