PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc04g071360.2.1
Common NameLOC101267228
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family Trihelix
Protein Properties Length: 655aa    MW: 71936.2 Da    PI: 6.5246
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc04g071360.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix93.12.7e-2960144187
            trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                         rW++qe+ aL+++r+em+  +r+++lk+plWeevs+km++ gf+rs+k+Ckek+en+ k++k++k+g+ ++   + +++++f+qlea
  Solyc04g071360.2.1  60 RWPRQETIALLKIRSEMDVIFRDSSLKGPLWEEVSRKMADLGFHRSSKKCKEKFENVYKYHKRTKDGRASK--ADGKNYRFFEQLEA 144
                         8********************************************************************95..67778*******85 PP

2trihelix103.71.3e-32461546187
            trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                         rW+k ev aLi++r++++ +++++  k+plWee+s+ m++ g++r++k+Ckekwen+nk++kk+ke++kkr +e+s+tcpyf+ql+a
  Solyc04g071360.2.1 461 RWPKAEVEALIKLRTNLDVKYQENGPKGPLWEEISSGMKKIGYNRNAKRCKEKWENINKYFKKVKESNKKR-PEDSKTCPYFHQLDA 546
                         8*********************************************************************8.99***********85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500907.02753117IPR017877Myb-like domain
SMARTSM007173.4E-457119IPR001005SANT/Myb domain
CDDcd122031.64E-2559124No hitNo description
PfamPF138378.9E-1959145No hitNo description
PROSITE profilePS500907.457454518IPR017877Myb-like domain
SMARTSM007174.6E-4458520IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.7E-4460517IPR009057Homeodomain-like
CDDcd122033.32E-28460525No hitNo description
PfamPF138372.3E-22460547No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 655 aa     Download sequence    Send to blast
MLGVSGLVSS EGGGDNPESG GGAGSGGSSE IGLGGGSGGG GGSSGGFMTE DGERNSGGNR  60
WPRQETIALL KIRSEMDVIF RDSSLKGPLW EEVSRKMADL GFHRSSKKCK EKFENVYKYH  120
KRTKDGRASK ADGKNYRFFE QLEALENITS HHSLMPVPSS NTRPPPPPLE ATPINMAMPM  180
ASSNVQVTAS QGTIPHHVTI SSAPPPPNSL FAPSHQNAPS SSPVPLPPPP SQQPSPQPAV  240
NPINNIPQQV NASAMSYSTS SSTSSDEDIQ RRHKKKRKWK DYFEKFTKDV INKQEESHRR  300
FLEKLEKREH DRMVREEAWK VEEMARMNRE HDLLVQERAM AAAKDAAVIS FLQKITEQQN  360
IQIPNSINVG PPSAQVQIQL PENPLSAPVP TQIQPTTVTA AAPPQPAPVP VSLPVTIPAP  420
VPALIPSLSL PLTPPVPSKN MELVPKSDNG GDSYSPASSS RWPKAEVEAL IKLRTNLDVK  480
YQENGPKGPL WEEISSGMKK IGYNRNAKRC KEKWENINKY FKKVKESNKK RPEDSKTCPY  540
FHQLDALYKE KAKNPETASS TSSFNPSFAL NPDNNQMAPI MARPEQQWPL PQHHESTTRI  600
DHENESDNMD EDDHDDEEDE DDEDENNAYE IVANKQQSSM AAANTTTSTA TTTV*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1269276QRRHKKKR
2269277QRRHKKKRK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.186160.0callus| fruit| leaf
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004237789.10.0PREDICTED: trihelix transcription factor GT-2-like
TrEMBLK4BTC80.0K4BTC8_SOLLC; Uncharacterized protein
STRINGSolyc04g071360.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24022459
Representative plantOGRP6631573
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76890.22e-79Trihelix family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]