PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc04g056270.2.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family CAMTA
Protein Properties Length: 1022aa    MW: 114147 Da    PI: 6.0806
Description CAMTA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc04g056270.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CG-1181.41.1e-56201362118
                CG-1   2 lkekkrwlkneeiaaiLenfekheltlelktrpksgsliLynrkkvryfrkDGyswkkkkdgktvrEdhekLKvggvevlycyYahseenp 92 
                         l+ ++rwl++ ei++iL+n++k++++ e+++rp+sgsl+L++rk++ryfrkDG+sw+kk+dgktv+E+he+LK g+++vl+cyYah+een+
  Solyc04g056270.2.1  20 LEAQHRWLRPAEICEILKNYQKFRIAPEPPNRPPSGSLFLFDRKVLRYFRKDGHSWRKKRDGKTVKEAHERLKAGSIDVLHCYYAHGEENE 110
                         5679*************************************************************************************** PP

                CG-1  93 tfqrrcywlLeeelekivlvhylevk 118
                         +fqrr+yw+Leee+++ivlvhy+evk
  Solyc04g056270.2.1 111 NFQRRSYWMLEEEMSHIVLVHYREVK 136
                         ***********************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5143782.72715141IPR005559CG-1 DNA-binding domain
SMARTSM010763.8E-7918136IPR005559CG-1 DNA-binding domain
PfamPF038599.0E-5021134IPR005559CG-1 DNA-binding domain
Gene3DG3DSA:2.60.40.102.9E-4513598IPR013783Immunoglobulin-like fold
SuperFamilySSF812965.6E-16514600IPR014756Immunoglobulin E-set
PfamPF018338.9E-5514592IPR002909IPT domain
SuperFamilySSF484034.82E-19618734IPR020683Ankyrin repeat-containing domain
Gene3DG3DSA:1.25.40.201.9E-19619735IPR020683Ankyrin repeat-containing domain
CDDcd002045.07E-15620732No hitNo description
PROSITE profilePS5029719.147623744IPR020683Ankyrin repeat-containing domain
PfamPF127966.1E-9645735IPR020683Ankyrin repeat-containing domain
PROSITE profilePS5008810.259673705IPR002110Ankyrin repeat
SMARTSM002480.0068673702IPR002110Ankyrin repeat
SMARTSM00248120712741IPR002110Ankyrin repeat
SuperFamilySSF525403.45E-6844897IPR027417P-loop containing nucleoside triphosphate hydrolase
SMARTSM0001548846868IPR000048IQ motif, EF-hand binding site
PROSITE profilePS500967.126848876IPR000048IQ motif, EF-hand binding site
PfamPF006120.098848867IPR000048IQ motif, EF-hand binding site
SMARTSM000150.0042869891IPR000048IQ motif, EF-hand binding site
PROSITE profilePS500969.285870894IPR000048IQ motif, EF-hand binding site
PfamPF006124.6E-4872891IPR000048IQ motif, EF-hand binding site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009409Biological Processresponse to cold
GO:0010150Biological Processleaf senescence
GO:0042742Biological Processdefense response to bacterium
GO:0045944Biological Processpositive regulation of transcription from RNA polymerase II promoter
GO:0050832Biological Processdefense response to fungus
GO:0005634Cellular Componentnucleus
GO:0001077Molecular Functiontranscriptional activator activity, RNA polymerase II core promoter proximal region sequence-specific binding
GO:0005515Molecular Functionprotein binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1022 aa     Download sequence    Send to blast
MADSRRYGLN AQLDIEQILL EAQHRWLRPA EICEILKNYQ KFRIAPEPPN RPPSGSLFLF  60
DRKVLRYFRK DGHSWRKKRD GKTVKEAHER LKAGSIDVLH CYYAHGEENE NFQRRSYWML  120
EEEMSHIVLV HYREVKGNRT NFSRIREPQQ VTPDLQETDE DVHSSEVDSS ASAKFYPNDY  180
QVNSQVTDTT SFSSAQASEY EDAESVYNQH PTSGFHSFLD AQPSAGDGLA VPYHPIPFSN  240
DQVQFAGSSG TSFSSIPPGN GNTSTANTYV PSRNLDFASW GTISVNNPAA YQSLHFQPSG  300
QSSANNMMHE QGNTTMGQIC SNDFTRQEHE NHIDGLGNWQ TSEVDSSFIS KWSMDQKLNP  360
DLTSGQTIGS SGVYGVEHHN SLEASQLLPA QQDKHPIQNE LQSQLSDANI GGSLNADLDH  420
NLSLGVKTDY SALKQPLLDG VLKREGLKKL DSFDRWISKE LGDVSESHMQ SNSSSYWDNV  480
GDEDGVGNST IASQVQLDTY VLSPSLAQDQ IFSIIDFSPN WAFSGSEIKV LITGRFLKSQ  540
QEVENCSWAC MFGELEVPAE VIADGVLRCH TPVQKAGRVP FYITCSNRLA CSEVREFEFR  600
VTEEKVKDQL LQKLLKEKLH VWLLQKVAEG GKGPNILDEG GQGVLHFAAA LGYDWAVPPT  660
IAAGVSVNFR DVNGWTALHW AASYGRERTV GFLISLGAAT GALTDPTPKH PSGRTPADLA  720
SSNGHKGIAG YLAESSLSSH LFSLELKEKK QGENEQAFGE AVQTVSERTA TPAWDGDWSH  780
GVSLKDSLAA VRNATQAAAR IHQVFRVQSF QRKQLKEYGG SEFGLSDERA LSLLAMKTNR  840
AGQHDEPHAA AVRIQNKFRS WKGRRDFLLI RQRIIKIQAH VRGHQVRNKY KNIIWSVGIL  900
EKVILRWRRK GSGLRGFKPE APTEGSNMQD QPVQEDDYDF LKEGRKQTEE RLQKALERVK  960
SMVQYPEARD QYRRLLNVVS DMQEPNSTAA SYNSAEAVDF NDDLIDLGDL LDDDTFMPTA  1020
P*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4hb5_A3e-1262473220122Engineered Protein
4hb5_B3e-1262473220122Engineered Protein
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.300.0cell culture| flower| fruit| leaf| root
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots, stems, leaves, carpels, and siliques, but not in stigmas or other parts of the flower. {ECO:0000269|PubMed:11162426, ECO:0000269|PubMed:12218065, ECO:0000269|PubMed:14581622}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds to the DNA consensus sequence 5'-[ACG]CGCG[GTC]-3'. Binds calmodulin in a calcium-dependent manner in vitro (PubMed:12218065). Regulates transcriptional activity in response to calcium signals (Probable). Involved in freezing tolerance in association with CAMTA1 and CAMTA2 (PubMed:23581962). Required for the cold-induced expression of DREB1B/CBF1, DREB1C/CBF2, ZAT12 and GOLS3 (PubMed:19270186). Involved in response to cold. Contributes together with CAMTA5 to the positive regulation of the cold-induced expression of DREB1A/CBF3, DREB1B/CBF1 and DREB1C/CBF2 (PubMed:28351986). Involved together with CAMTA2 and CAMTA4 in the positive regulation of a general stress response (GSR) (PubMed:25039701). Involved in the regulation of GSR amplitude downstream of MEKK1 (PubMed:25157030). Involved in the regulation of a set of genes involved in defense responses against pathogens (PubMed:18298954). Involved in the regulation of both basal resistance and systemic acquired resistance (SAR) (PubMed:21900483). Acts as negative regulator of plant immunity (PubMed:19122675, PubMed:21900483, PubMed:22345509, PubMed:28407487). Binds to the promoter of the defense-related gene EDS1 and represses its expression (PubMed:19122675). Binds to the promoter of the defense-related gene NDR1 and represses its expression (PubMed:22345509). Involved in defense against insects (PubMed:23072934, PubMed:22371088). Required for tolerance to the generalist herbivore Trichoplusia ni, and contributes to the positive regulation of genes associated with glucosinolate metabolism (PubMed:23072934). Required for tolerance to Bradysia impatiens larvae. Mediates herbivore-induced wound response (PubMed:22371088). Required for wound-induced jasmonate accumulation (PubMed:23072934, PubMed:22371088). Involved in the regulation of ethylene-induced senescence by binding to the promoter of the senescence-inducer gene EIN3 and repressing its expression (PubMed:22345509). {ECO:0000269|PubMed:12218065, ECO:0000269|PubMed:18298954, ECO:0000269|PubMed:19122675, ECO:0000269|PubMed:19270186, ECO:0000269|PubMed:21900483, ECO:0000269|PubMed:22345509, ECO:0000269|PubMed:22371088, ECO:0000269|PubMed:23072934, ECO:0000269|PubMed:23581962, ECO:0000269|PubMed:25039701, ECO:0000269|PubMed:25157030, ECO:0000269|PubMed:28351986, ECO:0000269|PubMed:28407487, ECO:0000305|PubMed:11925432}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc04g056270.2.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By heat shock, UVB, salt, wounding, ethylene and methyl jasmonate (PubMed:11162426, PubMed:12218065). Induced by infection with the fungal pathogen Golovinomyces cichoracearum (powdery mildew) and the bacterial pathogen Pseudomonas syringae pv tomato strain DC3000 (PubMed:22345509). {ECO:0000269|PubMed:11162426, ECO:0000269|PubMed:12218065, ECO:0000269|PubMed:22345509}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGU1708380.0Solanum lycopersicum cultivar Rutgers calmodulin-binding protein mRNA, complete cds
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019177324.10.0PREDICTED: calmodulin-binding transcription activator 3-like isoform X2
SwissprotQ8GSA70.0CMTA3_ARATH; Calmodulin-binding transcription activator 3
TrEMBLA0A3Q7G6830.0A0A3Q7G683_SOLLC; Uncharacterized protein
STRINGSolyc04g056270.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA22302146
Representative plantOGRP5621565
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22300.21e-149signal responsive 1
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]
  2. Zhang L,Du L,Shen C,Yang Y,Poovaiah BW
    Regulation of plant immunity through ubiquitin-mediated modulation of Ca(2+) -calmodulin-AtSR1/CAMTA3 signaling.
    Plant J., 2014. 78(2): p. 269-81
    [PMID:24528504]
  3. Benn G, et al.
    A key general stress response motif is regulated non-uniformly by CAMTA transcription factors.
    Plant J., 2014. 80(1): p. 82-92
    [PMID:25039701]
  4. Rahman H,Yang J,Xu YP,Munyampundu JP,Cai XZ
    Phylogeny of Plant CAMTAs and Role of AtCAMTAs in Nonhost Resistance to Xanthomonas oryzae pv. oryzae.
    Front Plant Sci, 2016. 7: p. 177
    [PMID:26973658]
  5. Benn G, et al.
    Plastidial metabolite MEcPP induces a transcriptionally centered stress-response hub via the transcription factor CAMTA3.
    Proc. Natl. Acad. Sci. U.S.A., 2016. 113(31): p. 8855-60
    [PMID:27432993]
  6. Kidokoro S, et al.
    Different Cold-Signaling Pathways Function in the Responses to Rapid and Gradual Decreases in Temperature.
    Plant Cell, 2017. 29(4): p. 760-774
    [PMID:28351986]
  7. Lolle S, et al.
    Matching NLR Immune Receptors to Autoimmunity in camta3 Mutants Using Antimorphic NLR Alleles.
    Cell Host Microbe, 2017. 21(4): p. 518-529.e4
    [PMID:28407487]
  8. Kim YS, et al.
    CAMTA-Mediated Regulation of Salicylic Acid Immunity Pathway Genes in Arabidopsis Exposed to Low Temperature and Pathogen Infection.
    Plant Cell, 2017. 29(10): p. 2465-2477
    [PMID:28982964]
  9. Jacob F, et al.
    A dominant-interfering camta3 mutation compromises primary transcriptional outputs mediated by both cell surface and intracellular immune receptors in Arabidopsis thaliana.
    New Phytol., 2018. 217(4): p. 1667-1680
    [PMID:29226970]