PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc04g054840.1.1
Common NameLOC101255685
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family EIL
Protein Properties Length: 504aa    MW: 58361.6 Da    PI: 4.7673
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc04g054840.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3362.29.2e-111333981343
                         XXXXXXXXXXXXXXXXXXXXXXX..XXXXX............XXXXXXX.........XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
                EIN3   1 eelkkrmwkdqmllkrlkerkkqlledkeaa...........tgakksn.........ksneqarrkkmsraQDgiLkYMlkemevcnaqG 71 
                         ++lk+rmwkd+ +++  k +k++ + + +a+                 +           +eq+rrkkmsraQD++LkYM+k+me+c+ qG
  Solyc04g054840.1.1  33 DDLKRRMWKDRKRMQIFKANKRDMMINTSATcseelsldqdeD-----EeeeedeesqAKKEQSRRKKMSRAQDSVLKYMVKIMEICKGQG 118
                         79*************9999999999887776666666555540.....155555555599******************************* PP

                         XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS-TTS- CS
                EIN3  72 fvYgiipekgkpvegasdsLraWWkekvefdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrf 162
                         fvYgi+pekgkpv+g+sdsLr+WWk+kv+f++n+p+ai+     +l+  +e+ l   ++s    l++lqDTtlgSLLs+lm+hc ppqrrf
  Solyc04g054840.1.1 119 FVYGIVPEKGKPVTGSSDSLREWWKDKVRFEKNAPNAIAAF-LPKLV--EENVL--VPNSCMDLLNDLQDTTLGSLLSSLMRHCIPPQRRF 204
                         ***************************************99.44566..33444..48899999*************************** PP

                         -TTT--HHHH---S--HHHHHHT--TT--.-----GGG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTT CS
                EIN3 163 plekgvepPWWPtGkelwwgelglskdqgtppykkphdlkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvlnqe 253
                         pl+kg++pPWWPtG+elwwg +g+s++ g+ppykkp+dlkkawkvsvL+  ikhms +++++r+l+ qsk+lq+km+ake++++++v+nqe
  Solyc04g054840.1.1 205 PLDKGLAPPWWPTGTELWWGDQGFSQEEGPPPYKKPRDLKKAWKVSVLAGIIKHMSVNFDKMRRLVKQSKSLQNKMTAKETATWSRVVNQE 295
                         ******************************************************************************************* PP

                         TT-S--XXXXXXXXXXXXXXXXXXXXXXXXXX..........XXXXXX.XXXXXXXXXX.....................XXXXXXXXXXX CS
                EIN3 254 ekecatvsahssslrkqspkvtlsceqkedve..........gkkeskikhvqavktta.....................gfpvvrkrkkk 313
                         e +++             +++++s++++ed+e           ++++k k v                            g+ +  k   +
  Solyc04g054840.1.1 296 EVLIKMTE----------KALKISTSKEEDQEnvegikedlaLRRNEKRKGV------FesdidtedmlyqnlncaqselGVGFPYKNS-R 369
                         *9885443..........4444444444433321211111112222222222......0222333557777788888877444444444.4 PP

                         XXXXXXXXXX......XXXXXXX.XXXXXX CS
                EIN3 314 psesakvsskevsrtcqssqfrgsetelif 343
                          ++++++s ++  ++ ++++++  e+ ++f
  Solyc04g054840.1.1 370 MDNETTCSHHGKQTMNEQQSVN-DESLNMF 398
                         5777777777664444444444.4444444 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048737.9E-11033296No hitNo description
Gene3DG3DSA:1.10.3180.104.5E-63173302IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167681.31E-55176299IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009873Biological Processethylene-activated signaling pathway
GO:0071281Biological Processcellular response to iron ion
GO:0080167Biological Processresponse to karrikin
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 504 aa     Download sequence    Send to blast
MVGFEEIIEP FSPINSELVE ENKEIDDEEI NYDDLKRRMW KDRKRMQIFK ANKRDMMINT  60
SATCSEELSL DQDEDEEEEE DEESQAKKEQ SRRKKMSRAQ DSVLKYMVKI MEICKGQGFV  120
YGIVPEKGKP VTGSSDSLRE WWKDKVRFEK NAPNAIAAFL PKLVEENVLV PNSCMDLLND  180
LQDTTLGSLL SSLMRHCIPP QRRFPLDKGL APPWWPTGTE LWWGDQGFSQ EEGPPPYKKP  240
RDLKKAWKVS VLAGIIKHMS VNFDKMRRLV KQSKSLQNKM TAKETATWSR VVNQEEVLIK  300
MTEKALKIST SKEEDQENVE GIKEDLALRR NEKRKGVFES DIDTEDMLYQ NLNCAQSELG  360
VGFPYKNSRM DNETTCSHHG KQTMNEQQSV NDESLNMFMN NFTSLIGTQP ILHKEIMVGD  420
DHHSEHDGMN MDIKRSVDNY HIAQYANRGS IEENFEVFWG DNNVLEQHHY DSIMNLNDTP  480
KENEHYQSPL SVWDLAYEDP SEL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4zds_A4e-531783006128Protein ETHYLENE INSENSITIVE 3
4zds_B4e-531783006128Protein ETHYLENE INSENSITIVE 3
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1328334RRNEKRK
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc04g054840.1.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010319747.10.0putative ETHYLENE INSENSITIVE 3-like 4 protein
TrEMBLA0A3Q7G4Y40.0A0A3Q7G4Y4_SOLLC; Uncharacterized protein
STRINGSolyc04g054840.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA30423178
Representative plantOGRP5631682
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G10120.11e-116EIL family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]