PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc04g051080.1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family ARR-B
Protein Properties Length: 543aa    MW: 61680.3 Da    PI: 6.0115
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc04g051080.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like54.52.5e-17216268356
             G2-like   3 rlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                          l+W+ +L ++F+++v+q+ G+e+  Pk+i e m+v ++t+++v+SHLQ YRl+
  Solyc04g051080.1.1 216 CLVWNDDLQAKFIKVVHQI-GIERCRPKKIWEQMNVLDITRTQVASHLQNYRLH 268
                         589****************.********************************97 PP

2Response_reg29.44.2e-11141161104
                         EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHH..HHHHESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHH CS
        Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealell..kekdpDlillDiempgmdGlellkeireeepklpiivvtahgeeedalea 89 
                         vl+vd ++ +   + ++l++ +y +v+++ ++++al +l  +++++D+i++    ++m  l+ll +  + +  +  +v+ ++ +e  a+++
  Solyc04g051080.1.1  14 VLLVDNDKEFVTEMINLLKSYDY-KVTTVNTSSAALSMLirEKQKFDVIIINDHSSNMLSLDLLAKAVAMD--IISVVICDKYNEFVAKKV 101
                         89*********************.***************877777*******9999999999999877765..555555666667****** PP

                         HHTTESEEEESS--H CS
        Response_reg  90 lkaGakdflsKpfdp 104
                         l+ Ga  ++++ f++
  Solyc04g051080.1.1 102 LNEGAYLYFENSFEK 116
                         ********9999876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.40.50.23003.5E-1111134No hitNo description
SuperFamilySSF521722.49E-1011136IPR011006CheY-like superfamily
PROSITE profilePS5011017.11113127IPR001789Signal transduction response regulator, receiver domain
PfamPF000721.3E-414112IPR001789Signal transduction response regulator, receiver domain
CDDcd001561.99E-515117No hitNo description
SuperFamilySSF466893.58E-14212271IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.3E-18213270IPR009057Homeodomain-like
TIGRFAMsTIGR015574.0E-17215268IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 543 aa     Download sequence    Send to blast
MASPNYGTIK EVHVLLVDND KEFVTEMINL LKSYDYKVTT VNTSSAALSM LIREKQKFDV  60
IIINDHSSNM LSLDLLAKAV AMDIISVVIC DKYNEFVAKK VLNEGAYLYF ENSFEKDIVK  120
YLSKFVSRKK TQRQQVEEGS EINIYQNNNI IGDNGESEER QNVSNTTNQR NNIDEAGNDV  180
GSNGKYKLTK KRERENTNEA DQREHQSSDF IRRKACLVWN DDLQAKFIKV VHQIGIERCR  240
PKKIWEQMNV LDITRTQVAS HLQNYRLHWK NSEKKKSTRR SSDQRFSNSS QQISSFQKSG  300
TIPSLQTNET NLQVHSNRTQ IVPEFPFPNL KTKNTSFGGE SSIQQLYRPQ LHAQPYYSTI  360
CNPFNDSSQW TKTYFAGELQ QQHGPLLDVL GSQGLQISNI ENTSSKPTMA FNGEYHNIQS  420
YYNMNHNVSH GASYLGSKKM SNENVGNAIT NDKNLNINVD NVTTILGSRL IPDIHVGDTS  480
TNEFSAIETN PSNIVVAKND QTEIHEESDS DENHDCDAYF DFANIDYLSQ NLESPSTDPP  540
SE*
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc04g051080.1.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025886280.10.0two-component response regulator ARR1-like
STRINGSolyc04g051080.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8132384
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G16857.11e-28response regulator 1
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]