PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc04g050070.1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family G2-like
Protein Properties Length: 355aa    MW: 39278.4 Da    PI: 6.9097
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc04g050070.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like106.31.7e-33228282155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         kpr+rWtpeLH+ Fveav++LGG+ekAtPk +l+lm+v++Lt++hvkSHLQkYR+
  Solyc04g050070.1.1 228 KPRMRWTPELHKVFVEAVNKLGGNEKATPKGVLKLMNVDSLTIYHVKSHLQKYRT 282
                         79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.168225285IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.3E-31226284IPR009057Homeodomain-like
SuperFamilySSF466895.2E-19226282IPR009057Homeodomain-like
TIGRFAMsTIGR015571.7E-25228282IPR006447Myb domain, plants
PfamPF002497.4E-10230281IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 355 aa     Download sequence    Send to blast
MNMQPALYIP RSSEAQHSSM GVSGAMPMSL PSLPKLEEKF PKLLDALHVI SEKELTTNLN  60
SPRAISSMSK SGTVGHLLSS TFGLHKDFHF SPTSSQETWT LYFPFISSGA SMSASQASHS  120
NVDSISLDDY PSGNKQNSWG KDSSHEFLAF PTNVPVQNGQ VESLVGVMAS DDHAKRSDWQ  180
EWADQLINDD DILGLGSSWS YIVIDVNFPD PEPKKSCPIG SPSSATSKPR MRWTPELHKV  240
FVEAVNKLGG NEKATPKGVL KLMNVDSLTI YHVKSHLQKY RTARYKPEPS EGISEKKPTI  300
ITEMPSLDLR TTTGITEALK MQMEVQNSFM NNLRYVIDLR QNKYSCTYSC FSCT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A3e-29228286260Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B3e-29228286260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A3e-29228286260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C3e-29228286260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D3e-29228286260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F3e-29228286260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H3e-29228286260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J3e-29228286260Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc04g050070.1.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015072629.10.0protein PHOSPHATE STARVATION RESPONSE 1-like
TrEMBLA0A0V0ICE00.0A0A0V0ICE0_SOLCH; Uncharacterized protein
STRINGSolyc04g050070.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA45822139
Representative plantOGRP7817262
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28610.13e-60phosphate starvation response 1
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]