PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc04g050000.1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family MYB_related
Protein Properties Length: 191aa    MW: 22223.8 Da    PI: 10.152
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc04g050000.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.46.9e-1864106246
                         SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                         +++T eEd  +++a+++lG++ W++Iar ++ gRt++ +k++w++
  Solyc04g050000.1.1  64 QPFTFEEDNTIIRAHAKLGNR-WAKIARLLP-GRTDNAIKNHWNS 106
                         79*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500905.761657IPR017877Myb-like domain
SMARTSM007170.0571059IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.7E-111365IPR009057Homeodomain-like
SuperFamilySSF466894.51E-2137114IPR009057Homeodomain-like
PROSITE profilePS5129424.64158112IPR017930Myb domain
SMARTSM007174.3E-1662110IPR001005SANT/Myb domain
PfamPF002495.2E-1664106IPR001005SANT/Myb domain
CDDcd001671.16E-1265108No hitNo description
Gene3DG3DSA:1.10.10.605.6E-2366111IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 191 aa     Download sequence    Send to blast
MEKLKKTRMI KRQWNPKEEE LLHKLVKELG AENLSLIVQL MSSQYEKSCR FHRLKQLNPQ  60
VDHQPFTFEE DNTIIRAHAK LGNRWAKIAR LLPGRTDNAI KNHWNSSLKR KHHSMLEDLT  120
LESPQPPLKK SLSIGEGQNL GIPYRSELSN FGFDRFPPFC LYLHIAPFGR ILPFSICTYN  180
NRSICIFESI *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A3e-2891112104MYB PROTO-ONCOGENE PROTEIN
1mse_C3e-2891112104C-Myb DNA-Binding Domain
1msf_C3e-2891112104C-Myb DNA-Binding Domain
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that functions in salt stress response. Acts as negative regulator of NHX7/SOS1 and CBL4/SOS3 induction in response to salt stress (PubMed:23809151). In response to auxin, activates the transcription of the auxin-responsive gene IAA19. The IAA19 transcription activation by MYB73 is enhanced by direct interaction between MYB73 and PYL8 (PubMed:24894996). {ECO:0000269|PubMed:23809151, ECO:0000269|PubMed:24894996}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc04g050000.1.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by salt stress. {ECO:0000269|PubMed:23809151}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCU4682940.0S.lycopersicum DNA sequence from clone LE_HBa-6D20 on chromosome 4, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010319954.11e-111transcription factor MYB73-like
SwissprotO231604e-36MYB73_ARATH; Transcription factor MYB73
TrEMBLA0A3Q7GVT11e-110A0A3Q7GVT1_SOLLC; Uncharacterized protein
STRINGSolyc04g050000.1.11e-139(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA1853534
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37260.16e-32myb domain protein 73
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]