PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc04g015290.2.1
Common NameLOC101251768
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family G2-like
Protein Properties Length: 320aa    MW: 34929.2 Da    PI: 6.4487
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc04g015290.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like103.41.4e-324296155
             G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                        kprlrWt +LHerF++av+qLGG+ kAtPk+i+++m+vkgLtl h+kSHLQkYRl
  Solyc04g015290.2.1 42 KPRLRWTADLHERFIDAVTQLGGPSKATPKAIMRTMGVKGLTLFHLKSHLQKYRL 96
                        79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.7E-313997IPR009057Homeodomain-like
PROSITE profilePS5129410.8913999IPR017930Myb domain
TIGRFAMsTIGR015571.1E-234297IPR006447Myb domain, plants
SuperFamilySSF466895.55E-164298IPR009057Homeodomain-like
PfamPF002496.3E-84495IPR001005SANT/Myb domain
PfamPF143791.8E-16140185IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 320 aa     Download sequence    Send to blast
MFPRLIQSQE DEFIHGCDVN VGIHHHNRVN GDPCLVLTSD PKPRLRWTAD LHERFIDAVT  60
QLGGPSKATP KAIMRTMGVK GLTLFHLKSH LQKYRLGKQS QKDLDEASKD GLTATYSLES  120
PCSGGTPQQL PASDLNEGFE VKEALRAQME VQSKLHLQVE AEKHLQIRQD AEQRYITMLE  180
KACKMLADQF IGDVVTENHQ ETYQGLNTKT QLSPLCNPHG LCPSESADFV GVHGPEDVSP  240
RIHPQRTDCS TESCLTSHES PAGLPVEGSS PGGKKRGLSG DSTQASYVWG EADMRSSGVH  300
VLPVNCFGIS GSNVQNVSN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A1e-184298258Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B1e-184298258Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A1e-184298157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B1e-184298157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C1e-184298157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D1e-184298157Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A1e-184298258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C1e-184298258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D1e-184298258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F1e-184298258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H1e-184298258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J1e-184298258Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.220510.0fruit| leaf| trichome
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc04g015290.2.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCU0743070.0S.lycopersicum DNA sequence from clone LE_HBa-203L19 on chromosome 4, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004236637.10.0protein PHR1-LIKE 3 isoform X1
TrEMBLA0A3Q7GS420.0A0A3Q7GS42_SOLLC; Uncharacterized protein
STRINGSolyc04g015290.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA97642027
Representative plantOGRP7817262
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G13640.13e-69G2-like family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]