PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc04g014260.1.1
Common NameLOC101246239
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family ZF-HD
Protein Properties Length: 248aa    MW: 27722.2 Da    PI: 7.5743
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc04g014260.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer102.33.3e-3254106356
         ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRre 56 
                         k +YkeClkNhA+ +GghavDGCgEf+p+ ge+g++++lkCaAC+CHRnFHR+ 
  Solyc04g014260.1.1  54 KPKYKECLKNHAVGIGGHAVDGCGEFLPA-GEDGSIDSLKCAACNCHRNFHRKI 106
                         679*************************9.999*******************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257744.0E-2156105IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047702.7E-2856105IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015662.6E-3056105IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.50657106IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene3DG3DSA:1.10.10.601.6E-29171246IPR009057Homeodomain-like
SuperFamilySSF466891.97E-18173245IPR009057Homeodomain-like
PROSITE profilePS500718.794182246IPR001356Homeobox domain
TIGRFAMsTIGR015651.0E-23184240IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009793Biological Processembryo development ending in seed dormancy
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 248 aa     Download sequence    Send to blast
MEFEDQQKQR DEEIAAAPRH NDSLDNSDLT TKMPPSPQLE LEPLTAVQLW TNNKPKYKEC  60
LKNHAVGIGG HAVDGCGEFL PAGEDGSIDS LKCAACNCHR NFHRKIAPPP IAAAAAGVGG  120
EPVPFVYHSH NQLPTYYRTL PPPCGYLQYH VAPNQRPLAL PSTSGGYRED QEDISHPNYS  180
GGSKKRFRTK FSQVQKDKMQ ELADKLGWRI QREDEELVQQ LCNETGITRQ VFKVWMHNNK  240
HTLGKKP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh5_A3e-211842421775ZF-HD homeobox family protein
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor. {ECO:0000250}.
UniProtPutative transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc04g014260.1.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCU9281326e-12S.lycopersicum DNA sequence from clone SL_MboI-49I21 on chromosome 4, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004236700.10.0zinc-finger homeodomain protein 2-like
SwissprotA2Z2595e-68ZHD1_ORYSI; Zinc-finger homeodomain protein 1
SwissprotQ6YXH55e-68ZHD1_ORYSJ; Zinc-finger homeodomain protein 1
TrEMBLA0A3Q7FZL40.0A0A3Q7FZL4_SOLLC; Uncharacterized protein
STRINGSolyc04g014260.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51824128
Representative plantOGRP9116237
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24660.15e-66homeobox protein 22
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]