PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc04g009440.2.1
Common NameSlNAC1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family NAC
Protein Properties Length: 302aa    MW: 34835.2 Da    PI: 7.8928
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc04g009440.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM165.71.6e-51131371128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                         lp+GfrFhPtd+elv++yL++k++g+++ + ++i+e+d+yk++Pw+Lp+k+  +ekewyfFs+rd+ky++g+r+nra+ +gyWkatg dk+
  Solyc04g009440.2.1  13 LPAGFRFHPTDDELVQHYLCRKCAGQSIAV-SIIAEIDLYKFDPWQLPEKALYGEKEWYFFSPRDRKYPNGSRPNRAAGTGYWKATGADKP 102
                         799*************************99.89***************8777889************************************ PP

                 NAM  92 vlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         v +   ++ g+kk Lvfy g+ap+g kt+W+mheyrl
  Solyc04g009440.2.1 103 VGK--PKTLGIKKALVFYAGKAPRGIKTNWIMHEYRL 137
                         *98..778***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.27E-619163IPR003441NAC domain
PROSITE profilePS5100559.27913163IPR003441NAC domain
PfamPF023653.8E-2714137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 302 aa     Download sequence    Send to blast
MNKGANGNQQ LELPAGFRFH PTDDELVQHY LCRKCAGQSI AVSIIAEIDL YKFDPWQLPE  60
KALYGEKEWY FFSPRDRKYP NGSRPNRAAG TGYWKATGAD KPVGKPKTLG IKKALVFYAG  120
KAPRGIKTNW IMHEYRLANV DRSAGKNNNL RLDDWVLCRI YNKKGTLEKH YNVDNKETTS  180
FGEFDEEIKP KILPTQLAPM PPRPRSTPAN DYFYFESSES MTRMHTTNSS SGSEHVLSPC  240
DKEVQSAPKW DEDHRNTLDF QLNYLDGLLN EPFETQMQQQ ICNFDQFNNF QDMFLYMQKP  300
Y*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A8e-8611693174Stress-induced transcription factor NAC1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.44830.0cell culture| flower| fruit| leaf| root| stem
Function -- GeneRIF ? help Back to Top
  1. Upregulation of the NAC1 gene is associated with pathogen infection defense.
    [PMID: 23278405]
  2. SlNAC1 was highly accumulated in immature green fruits; expression increased with fruit ripening until 7 days after the breaker stage. Overexpression resulted in reduced carotenoids by altering carotenoid pathway flux and decreasing ethylene synthesis.
    [PMID: 25491370]
  3. The tomato defense-related transcription factor NAC1 interacts with the ubiquitin ligase SINA3.SINA3 possesses ubiquitin ligase activity and ubiquitinates NAC1.
    [PMID: 26879496]
  4. SlNAC1 is involved in controlling tomato fruit ripening. SlNAC1 inhibited the expressions of SlACS2, SlACS4, SlACO1, and SlPSY1; as a result, ethylene and lycopene levels were reduced. [SlNAC1]
    [PMID: 26962710]
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc04g009440.2.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY4987130.0Lycopersicon esculentum NAC domain protein mRNA, complete cds
GenBankEU6707500.0Solanum lycopersicum cultivar LA2711 NAC domain protein 1 (SlNAC1) mRNA, complete cds
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001234482.10.0NAC domain protein
SwissprotQ390131e-123NAC2_ARATH; NAC domain-containing protein 2
TrEMBLM9TNM60.0M9TNM6_SOLPI; NAC domain protein
TrEMBLQ6RH270.0Q6RH27_SOLLC; NAC domain protein
STRINGSolyc04g009440.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12392481
Representative plantOGRP1715800
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01720.11e-123NAC family protein
Publications ? help Back to Top
  1. Selth LA, et al.
    A NAC domain protein interacts with tomato leaf curl virus replication accessory protein and enhances viral replication.
    Plant Cell, 2005. 17(1): p. 311-25
    [PMID:15608335]
  2. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]
  3. Ouyang B, et al.
    Identification of early salt stress response genes in tomato root by suppression subtractive hybridization and microarray analysis.
    J. Exp. Bot., 2007. 58(3): p. 507-20
    [PMID:17210988]
  4. Huang W, et al.
    SlNAC1, a stress-related transcription factor, is fine-tuned on both the transcriptional and the post-translational level.
    New Phytol., 2013. 197(4): p. 1214-24
    [PMID:23278405]
  5. Florentin A,Damri M,Grafi G
    Stress induces plant somatic cells to acquire some features of stem cells accompanied by selective chromatin reorganization.
    Dev. Dyn., 2013. 242(10): p. 1121-33
    [PMID:23798027]
  6. Jensen MK, et al.
    ATAF1 transcription factor directly regulates abscisic acid biosynthetic gene NCED3 in Arabidopsis thaliana.
    FEBS Open Bio, 2013. 3: p. 321-7
    [PMID:23951554]
  7. Wang YX
    Characterization of a novel Medicago sativa NAC transcription factor gene involved in response to drought stress.
    Mol. Biol. Rep., 2013. 40(11): p. 6451-8
    [PMID:24057250]
  8. Ma N, et al.
    Overexpression of tomato SlNAC1 transcription factor alters fruit pigmentation and softening.
    BMC Plant Biol., 2014. 14: p. 351
    [PMID:25491370]
  9. Yang X, et al.
    Overexpression of a Miscanthus lutarioriparius NAC gene MlNAC5 confers enhanced drought and cold tolerance in Arabidopsis.
    Plant Cell Rep., 2015. 34(6): p. 943-58
    [PMID:25666276]
  10. Du Q,Wang H
    The role of HD-ZIP III transcription factors and miR165/166 in vascular development and secondary cell wall formation.
    Plant Signal Behav, 2015. 10(10): p. e1078955
    [PMID:26340415]
  11. Lapidot M, et al.
    A Novel Route Controlling Begomovirus Resistance by the Messenger RNA Surveillance Factor Pelota.
    PLoS Genet., 2015. 11(10): p. e1005538
    [PMID:26448569]
  12. Takasaki H, et al.
    SNAC-As, stress-responsive NAC transcription factors, mediate ABA-inducible leaf senescence.
    Plant J., 2015. 84(6): p. 1114-23
    [PMID:26518251]
  13. Miao M, et al.
    The ubiquitin ligase SEVEN IN ABSENTIA (SINA) ubiquitinates a defense-related NAC transcription factor and is involved in defense signaling.
    New Phytol., 2016. 211(1): p. 138-48
    [PMID:26879496]
  14. Meng C, et al.
    Suppression of tomato SlNAC1 transcription factor delays fruit ripening.
    J. Plant Physiol., 2016. 193: p. 88-96
    [PMID:26962710]
  15. Liu Y,Sun J,Wu Y
    Arabidopsis ATAF1 enhances the tolerance to salt stress and ABA in transgenic rice.
    J. Plant Res., 2016. 129(5): p. 955-962
    [PMID:27216423]
  16. Ghandchi FP,Caetano-Anolles G,Clough SJ,Ort DR
    Investigating the Control of Chlorophyll Degradation by Genomic Correlation Mining.
    PLoS ONE, 2016. 11(9): p. e0162327
    [PMID:27618630]
  17. Zhao J,Missihoun TD,Bartels D
    The ATAF1 transcription factor is a key regulator of aldehyde dehydrogenase 7B4 (ALDH7B4) gene expression in Arabidopsis thaliana.
    Planta, 2018. 248(4): p. 1017-1027
    [PMID:30027414]