PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc04g008480.1.1
Common NameLOC101255580
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family G2-like
Protein Properties Length: 298aa    MW: 34040.1 Da    PI: 8.0571
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc04g008480.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.72.2e-321972255
             G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                        prlrWtp+LH++Fv+a+e+LGG++kAtPk +l++m+v gLt+++vkSHLQ+YR+
  Solyc04g008480.1.1 19 PRLRWTPDLHHCFVHAIEKLGGQDKATPKLVLQMMDVRGLTISNVKSHLQMYRS 72
                        8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.6821575IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.5E-311575IPR009057Homeodomain-like
SuperFamilySSF466891.97E-151774IPR009057Homeodomain-like
TIGRFAMsTIGR015573.8E-241973IPR006447Myb domain, plants
PfamPF002491.1E-82071IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 298 aa     Download sequence    Send to blast
MGNCGRNGGV RQYIRSKVPR LRWTPDLHHC FVHAIEKLGG QDKATPKLVL QMMDVRGLTI  60
SNVKSHLQMY RSMKSDVNKQ GERMTIQPSK EVCLGDLDCH YQQQEQEDEG CVEQQKLLVY  120
QYPLSFSSNP NMKRTDSTPY FNSVQPTKRA RIERCSIREA VSNEYNSRND YNTEKNETTQ  180
PLCNSTTHIF NPLTTSNELQ ESLFFKVLKT QDSNRDSLKR FKFEDSMKID NVREDDDERG  240
LSLSLSLHRP TTQRSNASSI ISEISETISS YSGGLNLNIW QSSSEKQNVN LNLSIAL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-172074458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-172074458Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A2e-172074357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-172074357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-172074357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-172074357Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-172074458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-172074458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-172074458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-172074458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-172074458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-172074458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Function -- GeneRIF ? help Back to Top
  1. CLAU modulates leaf morphogenesis by curbing the leaf's morphogenetic potential. [clausa]
    [PMID: 26189897]
  2. Study show that CLAU attenuates cytokinin signaling, and that clau plants have increased cytokinin sensitivity. The results suggest that flexible leaf patterning involves a coordinated interplay between transcription factors and hormones.
    [PMID: 27385816]
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc04g008480.1.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2401974e-10Solanum lycopersicum strain Heinz 1706 chromosome 10 clone hba-208l2 map 10, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004236899.20.0putative Myb family transcription factor At1g14600
TrEMBLA0A3Q7GPB20.0A0A3Q7GPB2_SOLLC; Uncharacterized protein
STRINGSolyc04g008480.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA54332238
Representative plantOGRP28515123
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02060.15e-34G2-like family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]
  2. Bar M, et al.
    CLAUSA Is a MYB Transcription Factor That Promotes Leaf Differentiation by Attenuating Cytokinin Signaling.
    Plant Cell, 2016. 28(7): p. 1602-15
    [PMID:27385816]