PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc04g008050.2.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family ARR-B
Protein Properties Length: 655aa    MW: 71628.8 Da    PI: 7.2644
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc04g008050.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like89.62.9e-28211264155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         kpr++W+ eLH++Fv+av+qL G++kA+Pk+ilelm+v+gLt+e+v+SHLQk+Rl
  Solyc04g008050.2.1 211 KPRVVWSVELHQQFVSAVNQL-GIDKAVPKRILELMNVPGLTRENVASHLQKFRL 264
                         79*******************.********************************8 PP

2Response_reg76.68.7e-26281361109
                         EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHH CS
        Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalea 89 
                         vl+vdD+ + +++++q+l++ +y +v++++++  al+ll+ek+  +D++l D+ mp+mdG++ll+     e++lp+i++++ g  +++ + 
  Solyc04g008050.2.1  28 VLVVDDDVVCLRIIEQMLRRCKY-SVTTCTQAMVALNLLREKRgtFDIVLSDVHMPDMDGFKLLELVGL-EMDLPVIMMSGDGRTNLVMRG 116
                         89*********************.***************999999*******************87754.558****************** PP

                         HHTTESEEEESS--HHHHHH CS
        Response_reg  90 lkaGakdflsKpfdpeelvk 109
                         ++ Ga d+l Kp+  eel +
  Solyc04g008050.2.1 117 VQHGACDYLIKPIRDEELKN 136
                         *****************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF521723.84E-3525150IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23008.6E-4125149No hitNo description
SMARTSM004482.8E-2926138IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011042.29227142IPR001789Signal transduction response regulator, receiver domain
PfamPF000727.1E-2328136IPR001789Signal transduction response regulator, receiver domain
CDDcd001562.32E-2240141No hitNo description
PROSITE profilePS5129410.655208267IPR017930Myb domain
SuperFamilySSF466891.42E-19208268IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.1E-29209269IPR009057Homeodomain-like
TIGRFAMsTIGR015572.4E-24211264IPR006447Myb domain, plants
PfamPF002499.4E-7213262IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0042802Molecular Functionidentical protein binding
Sequence ? help Back to Top
Protein Sequence    Length: 655 aa     Download sequence    Send to blast
MVSMSGEVAT CKSEATVVTD HFPVGLRVLV VDDDVVCLRI IEQMLRRCKY SVTTCTQAMV  60
ALNLLREKRG TFDIVLSDVH MPDMDGFKLL ELVGLEMDLP VIMMSGDGRT NLVMRGVQHG  120
ACDYLIKPIR DEELKNIWQH VVRKRYNSSK EPECSGSLDD NDRYRRRSDD AECASSVIEG  180
ADGVLKPQKK KREAKEDDTE MENDDPSTTK KPRVVWSVEL HQQFVSAVNQ LGIDKAVPKR  240
ILELMNVPGL TRENVASHLQ KFRLYLKRLS GVVQQQGGLP STFCGPIEQN SELGSLGRFD  300
IQALAASGQI PPETLTALHA ELLGRSTSNL VLPAVEQQNL VQVSLQQAKC IPVDQVMAYG  360
QPLLKCPASI SNSKHLSQAI LSAEDVHSGF GSQRAKNICM VPSSNPIAPN SNMLTAMMQQ  420
QQWQKQQQIE LQHRQSGPPE VNRSINVQPS CLVLPSQLPG HFQVGDSPAS ISRAGSLSKS  480
SVIDYGVLSP QSNNSSGVVQ VLDRELKPEC GLNRLPSGGS LSRSCSINAD NSVDLQLHNS  540
SSAFGSSKQL PGLIPSHLGS PVPYCINSSL VLDQGRMKGA SIPSRFAVDE SDSPMCNFNT  600
AKIYLEETKV KQEPNMNVME NAKVGPAIFQ KFQPGDLMSV FRLSFARVKV SSSP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A2e-22207270164ARR10-B
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.81010.0callus| fruit| leaf
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250|UniProtKB:Q940D0}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc04g008050.2.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004236929.10.0two-component response regulator ARR14 isoform X2
SwissprotA2XE311e-146ORR21_ORYSI; Two-component response regulator ORR21
TrEMBLA0A3Q7FVW70.0A0A3Q7FVW7_SOLLC; Uncharacterized protein
STRINGSolyc04g008050.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA77492130
Representative plantOGRP29217120
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G16857.11e-105response regulator 1
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]