PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc04g007210.2.1
Common NameLOC101255581
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family CO-like
Protein Properties Length: 429aa    MW: 48719.4 Da    PI: 5.1304
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc04g007210.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box30.57.4e-101659340
            zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvv 40
                        +r C+++ +k+++++C  ++ +lC++C ++ H+       H++v
  Solyc04g007210.2.1 16 ARACDNCIRKRARWYCAADDAFLCQSCDSSVHSAnplarrHERV 59
                        578*****************************667888888876 PP

2CCT691.2e-23373416144
                 CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                         Rea++lRYkeKr+tR+F+KkirYe+RK +Ae+RpR+KGrFvk++
  Solyc04g007210.2.1 373 REARVLRYKEKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRT 416
                         9*****************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003364.8E-111461IPR000315B-box-type zinc finger
PROSITE profilePS5011911.0351461IPR000315B-box-type zinc finger
PfamPF006433.2E-81659IPR000315B-box-type zinc finger
CDDcd000219.63E-111761No hitNo description
PROSITE profilePS5101716.003373415IPR010402CCT domain
PfamPF062034.0E-18373415IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 429 aa     Download sequence    Send to blast
MSSEKKLANA MGAKTARACD NCIRKRARWY CAADDAFLCQ SCDSSVHSAN PLARRHERVR  60
LKTSSFKSSD DFPNLESTVS GLGSGSGSGS DSIPSWHCGF TRKARTPRYG NKHAKRVKST  120
EEEEEEEEMK NPIQLVVPEI LSDENSHDEN EEEQLLYRVP IFDPFMADGS NYGNEYSSNK  180
VDFNQDMNTF QGLLAPSEME LAEFAADVVS LLGKGLDDEE SFNYMEGLGF LEKHDEKLVK  240
VEDEGEVGFV NMISTNNQVD YSEFDMVGET FELKFDYDSQ VINNLDEDNK KVEFLEINYD  300
SGKNNNKIML NLDYESVLKS WGDKRFPWTT GVRPEVDFND CWPVCMGNCG KIHSYGDIAI  360
MNGHGGGVVD EGREARVLRY KEKRRTRLFS KKIRYEVRKL NAEKRPRMKG RFVKRTNFAP  420
TPFPSLNK*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1383399RRTRLFSKKIRYEVRKL
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.244020.0leaf
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc04g007210.2.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004236986.10.0zinc finger protein CONSTANS-LIKE 16
TrEMBLA0A3Q7FVI40.0A0A3Q7FVI4_SOLLC; Uncharacterized protein
STRINGSolyc04g007210.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA15392470
Representative plantOGRP8021649
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25440.11e-88B-box type zinc finger protein with CCT domain
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]