PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc03g121400.1.1
Common NameLOC101246611
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family Dof
Protein Properties Length: 211aa    MW: 22590.7 Da    PI: 9.2388
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc03g121400.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1239.7e-391676262
              zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                        ++++lkcprCds ntkfCyynny+lsqPr++Ck+CrryWtkGG+lrn+PvGgg+rk+ k+s
  Solyc03g121400.1.1 16 EQEHLKCPRCDSPNTKFCYYNNYNLSQPRHYCKSCRRYWTKGGTLRNIPVGGGSRKSTKRS 76
                        57899***************************************************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074787.0E-27868IPR003851Zinc finger, Dof-type
PfamPF027018.7E-331874IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.8632074IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102258IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 211 aa     Download sequence    Send to blast
MQDPSIYSQI KPQFPEQEHL KCPRCDSPNT KFCYYNNYNL SQPRHYCKSC RRYWTKGGTL  60
RNIPVGGGSR KSTKRSSSSS SSSKKSSSTS TTSPATPPLT SSSSSTNPKP EPFGIPAIPS  120
FDVMTTSTGP FSSLLASTEP QFGNFLEALN PNNNNGSTLQ LGNPVSSSGH QNGNTSYLGV  180
QNGGESNNCW NGGNNGWPDL AIFTPGSNFQ *
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.142810.0callus| flower| fruit| leaf
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc03g121400.1.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004235615.11e-150dof zinc finger protein DOF3.1
SwissprotO821556e-43DOF17_ARATH; Dof zinc finger protein DOF1.7
TrEMBLA0A3Q7FVZ11e-149A0A3Q7FVZ1_SOLLC; Uncharacterized protein
STRINGSolyc03g121400.1.11e-150(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8824419
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G51700.13e-37DOF zinc finger protein 1
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]
  2. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  3. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]