PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc03g119540.2.1
Common NameLOC101254370
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family CO-like
Protein Properties Length: 409aa    MW: 46692.9 Da    PI: 4.9222
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc03g119540.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box30.67e-101760340
            zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvv 40
                        +r C+ + +k++++fC  ++ +lC++C +++H+       H++v
  Solyc03g119540.2.1 17 ARACDSCLSKRARWFCPADDAFLCQSCDVSIHSAnqlasrHERV 60
                        578*****************************667888888876 PP

2CCT67.73.1e-23349392144
                 CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                         Rea+++RY+eKr++R+F+KkirYe+RK +Ae+RpR+KGrF k++
  Solyc03g119540.2.1 349 REARVSRYREKRQNRLFSKKIRYEVRKLNAEKRPRLKGRFIKRS 392
                         9****************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003364.1E-121562IPR000315B-box-type zinc finger
PROSITE profilePS5011910.8791562IPR000315B-box-type zinc finger
PfamPF006438.3E-81760IPR000315B-box-type zinc finger
CDDcd000213.81E-111862No hitNo description
PROSITE profilePS5101715.835349391IPR010402CCT domain
PfamPF062033.6E-18349391IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009641Biological Processshade avoidance
GO:0010223Biological Processsecondary shoot formation
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005730Cellular Componentnucleolus
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 409 aa     Download sequence    Send to blast
MMTSESKTAN AIGGKTARAC DSCLSKRARW FCPADDAFLC QSCDVSIHSA NQLASRHERV  60
RLETCSNKST ITKLVDKTHQ PSWHQGFTRK ARTPRNGKKA QIRQWKKNEE NRVPEIGSEE  120
NSLDENEFEN EEQLLYRVPI FDPFEAELCN VPDETGSIVD LDILLNTEDA CHDLNLPEFL  180
SSDIELAEFA ADVETLLGGE EEQSTQLLNA DFENNKAIKI EVEDEEMRAV VACHLDPELD  240
MEREALNWNF DEYYEETVEQ KVMAADAAVT EFIASAEEYS GSSTKSDEKN RLFLSLNHEA  300
VISAWPNQSS PWTNGIRPHF NPDDYWPDFF SETSVGNYGG HVRCGDGGRE ARVSRYREKR  360
QNRLFSKKIR YEVRKLNAEK RPRLKGRFIK RSSSLFSVPG FSYMMNKR*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.86860.0fruit| leaf| trichome
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc03g119540.2.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004235805.10.0zinc finger protein CONSTANS-LIKE 16
TrEMBLA0A3Q7FT330.0A0A3Q7FT33_SOLLC; Uncharacterized protein
STRINGSolyc03g119540.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA15392470
Representative plantOGRP8021649
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68520.19e-88B-box type zinc finger protein with CCT domain
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]