PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc03g118770.2.1
Common NameLOC101252569
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family WOX
Protein Properties Length: 394aa    MW: 44057.7 Da    PI: 7.1324
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc03g118770.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox69.63.8e-2276135357
                         --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
            Homeobox   3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                         +R+++t+eql++Leel+++ +r+psae++++++++l    +++ ++V++WFqN++a+e++
  Solyc03g118770.2.1  76 SRWNPTPEQLQTLEELYRRgTRTPSAEQIQHITAQLrrygKIEGKNVFYWFQNHKARERQ 135
                         7*****************99**************************************97 PP

2Wus_type_Homeobox115.42.7e-3775137365
   Wus_type_Homeobox   3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                         ++RW+PtpeQ++ Leely++G+rtP++e+iq+ita+L++yGkie+kNVfyWFQN+kaRerqk+
  Solyc03g118770.2.1  75 SSRWNPTPEQLQTLEELYRRGTRTPSAEQIQHITAQLRRYGKIEGKNVFYWFQNHKARERQKR 137
                         79***********************************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003892.5E-573140IPR001356Homeobox domain
SuperFamilySSF466892.27E-1276140IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.5E-976135IPR009057Homeodomain-like
PfamPF000466.8E-2076135IPR001356Homeobox domain
CDDcd000864.31E-677137No hitNo description
PROSITE profilePS5007111.25681136IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048513Biological Processanimal organ development
GO:0099402Biological Processplant organ development
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 394 aa     Download sequence    Send to blast
MWMMGYNEGG DFNMSDSCNG RKLRPLMPRV PHAPTANPTN CLRNFHGENF IALNHHQLAM  60
SEQNKRDFNT QLVVSSRWNP TPEQLQTLEE LYRRGTRTPS AEQIQHITAQ LRRYGKIEGK  120
NVFYWFQNHK ARERQKRRRQ LESSANGNGN GGGGDDQSQS NCNAENAERK ESGANRTVFE  180
IEQTKHWPSP TNCSTLAEKT AAKTKAGAAS AAAGATAAGV AESCRVAAAE RWIPFDEGEQ  240
RRSLLAERNA TWQMMHLSCS PPTINNNTNC ATICSNTITT ATCTPIIRSC PSTPTTIDHQ  300
TKQLFKPKDH LNIFITPFRC DQKHQNIIGD EEEEGEGNGH EAQTLELFPL RSSNDNNDEN  360
NFSDKDEIGA AANLNNNFNG SHYQFFEFLP LKN*
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc03g118770.2.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB2872961e-10Solanum lycopersicum Tm-1^GCR237 mRNA for Tm-1 protein, complete cds
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025885968.10.0WUSCHEL-related homeobox 1 isoform X1
RefseqXP_025885969.10.0WUSCHEL-related homeobox 1 isoform X1
TrEMBLM1A4950.0M1A495_SOLTU; Uncharacterized protein
STRINGSolyc03g118770.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA46812342
Representative plantOGRP8416716
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18010.14e-52WUSCHEL related homeobox 1
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]