PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc03g118160.1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family LFY
Protein Properties Length: 430aa    MW: 47990.9 Da    PI: 6.9528
Description LFY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc03g118160.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FLO_LFY619.46.4e-18914111386
             FLO_LFY   1 mdpeafsaslfkwdpraaaaapparlleeaavseap.............leaaaaaaarklreleelfkayGvryltvakiaelGftvstL 78 
                         mdp+afsaslfkwdpr a+ +pp+rlle  a +++p             +++ +  ++r+l +leelf+ayG+ry+t+akiaelGftv+tL
  Solyc03g118160.1.1   1 MDPDAFSASLFKWDPRGAM-PPPSRLLEPVAPPQPPpslppppppqplpTSSYSIRSTRELGGLEELFQAYGIRYYTAAKIAELGFTVNTL 90 
                         9**************9887.666677666665555456666665554434444444455566***************************** PP

             FLO_LFY  79 vdmkdeelddlmkslseifrldllvGeryGikaavraerrrleeeeaekkrrkllsedeetaldalsqeglseepvqeekeaagsggeglg 169
                         +dmkdeeldd+m+sls+ifr+dllvGeryGikaa+rae rrleeee +++r ++ls+  +++ldalsqeglseepvq+++e+ ++g +g g
  Solyc03g118160.1.1  91 LDMKDEELDDMMNSLSQIFRWDLLVGERYGIKAAIRAEWRRLEEEE-ARRRGHILSDGGTNVLDALSQEGLSEEPVQQQHEREAAGSGGGG 180
                         ********************************************88.88888999999999****************97776555556666 PP

             FLO_LFY 170 eaelvaaeekkseeekkkaskkkqkrkkkkelkseededeeeeededeegsgedgeerqrehPfivtepgevargkknGLDYLfdLyeqCr 260
                         ++e++a    +++++++k+ + +++r +++e  ++e+  ee+ee+ ++ g+g + +erqrehPfivtepgevargkknGLDYLf+LyeqCr
  Solyc03g118160.1.1 181 TWEVAAGGGGRMKQRRRKK-AGRERRGEEDE--ETEELGEEDEENMNQGGGGGGISERQREHPFIVTEPGEVARGKKNGLDYLFHLYEQCR 268
                         9999999875555554444.23455444444..33444444455555556666667*********************************** PP

             FLO_LFY 261 efLlqvqkiakerGekcPtk.................vtnqvfryakkagasyinkPkmrhYvhCYalhcLdeeasnalrrafkergenvG 334
                         +fL+qvq+iakerGekcPtk                 vtnqvfryakkagasyinkPkmrhYvhCYalhcLde+asnalrrafkergenvG
  Solyc03g118160.1.1 269 DFLIQVQTIAKERGEKCPTKrtsligsksnhylsynyVTNQVFRYAKKAGASYINKPKMRHYVHCYALHCLDEDASNALRRAFKERGENVG 359
                         *******************9888888888888888889***************************************************** PP

             FLO_LFY 335 awrqacykplvaiaarqgwdidavfnahprLsiWYvPtkLrqLChlerskas 386
                         awrqacykplvaiaarqgwdida+fnahprL+iWYvPtkLrqLCh ers+a+
  Solyc03g118160.1.1 360 AWRQACYKPLVAIAARQGWDIDAIFNAHPRLAIWYVPTKLRQLCHSERSNAA 411
                         *************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF016981.9E-2121411IPR002910Floricaula/leafy protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010582Biological Processfloral meristem determinacy
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0031490Molecular Functionchromatin DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0043621Molecular Functionprotein self-association
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000003anatomywhole plant
PO:0009046anatomyflower
PO:0009049anatomyinflorescence
PO:0009081anatomyinflorescence branch
Sequence ? help Back to Top
Protein Sequence    Length: 430 aa     Download sequence    Send to blast
MDPDAFSASL FKWDPRGAMP PPSRLLEPVA PPQPPPSLPP PPPPQPLPTS SYSIRSTREL  60
GGLEELFQAY GIRYYTAAKI AELGFTVNTL LDMKDEELDD MMNSLSQIFR WDLLVGERYG  120
IKAAIRAEWR RLEEEEARRR GHILSDGGTN VLDALSQEGL SEEPVQQQHE REAAGSGGGG  180
TWEVAAGGGG RMKQRRRKKA GRERRGEEDE ETEELGEEDE ENMNQGGGGG GISERQREHP  240
FIVTEPGEVA RGKKNGLDYL FHLYEQCRDF LIQVQTIAKE RGEKCPTKRT SLIGSKSNHY  300
LSYNYVTNQV FRYAKKAGAS YINKPKMRHY VHCYALHCLD EDASNALRRA FKERGENVGA  360
WRQACYKPLV AIAARQGWDI DAIFNAHPRL AIWYVPTKLR QLCHSERSNA AAAASSSVSG  420
GVADHLPHF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2vy1_A1e-1062334203173PROTEIN LEAFY
2vy2_A1e-1062334203173PROTEIN LEAFY
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in floral meristems and in indeterminate vegetative meristems.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that act to specify determinacy in the progenitor cells for both flowers and leaves.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00095SELEXTransfer from AT5G61850Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc03g118160.1.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF1979340.0Lycopersicon esculentum FLORICAULA/LEAFY-like protein (FALSIFLORA) mRNA, complete cds
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015069882.10.0protein ALF isoform X2
SwissprotQ405040.0FL1_TOBAC; Floricaula/leafy homolog 1
TrEMBLA0A3Q7FS980.0A0A3Q7FS98_SOLLC; Uncharacterized protein
STRINGSolyc03g118160.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA66682333
Representative plantOGRP70181619
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61850.11e-137floral meristem identity control protein LEAFY (LFY)
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]