PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc03g116070.1.1
Common NameLOC101253676
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family ZF-HD
Protein Properties Length: 84aa    MW: 9037.14 Da    PI: 8.5074
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc03g116070.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer99.81.9e-312174358
         ZF-HD_dimer  3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58
                        +vrY eC++NhAa++Gg+avDGC+Efm++ g++  +aal+CaACgCHRnFHRrev+
  Solyc03g116070.1.1 21 NVRYVECQRNHAANIGGYAVDGCREFMAT-GDD-GTAALTCAACGCHRNFHRREVD 74
                        79**************************9.555.4789***************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257741.0E-14283IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047707.8E-292173IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015662.7E-252373IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152324.82472IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048509Biological Processregulation of meristem development
Sequence ? help Back to Top
Protein Sequence    Length: 84 aa     Download sequence    Send to blast
MMKKRQVVVR RISSGSSTIR NVRYVECQRN HAANIGGYAV DGCREFMATG DDGTAALTCA  60
ACGCHRNFHR REVDGGEVVS ESS*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.70341e-141leaf| root
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Mostly expressed in roots, stems and flowers, present in seedlings and leaves, and weakly observed in inflorescence and siliques. {ECO:0000269|PubMed:16412086, ECO:0000269|PubMed:18713354}.
Functional Description ? help Back to Top
Source Description
UniProtInhibits zinc finger homeodomain (ZHD) transcription factors by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by regulating the expression of specific genes. Promotes the formation of ectopic shoot meristems on leaf margins. {ECO:0000269|PubMed:21455630}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc03g116070.1.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015069341.17e-55mini zinc finger protein 3
RefseqXP_019068279.17e-55mini zinc finger protein 3
SwissprotQ2Q4938e-33MIF3_ARATH; Mini zinc finger protein 3
TrEMBLA0A3Q7FTE02e-53A0A3Q7FTE0_SOLLC; Uncharacterized protein
STRINGSolyc03g116070.1.13e-54(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11052486
Representative plantOGRP9116237
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18835.12e-23mini zinc finger
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]