PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc03g116010.1.1
Common NameLOC101259929
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family Nin-like
Protein Properties Length: 312aa    MW: 36029.8 Da    PI: 4.6032
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc03g116010.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK78.47.9e-25144192452
              RWP-RK   4 eisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                          +s + +skyF++pi+ AAkeL+++lT+LK++CR +GI+RWPhRk+ sl
  Solyc03g116010.1.1 144 MLSRDAISKYFYMPITRAAKELNIGLTLLKKRCRDLGIRRWPHRKLMSL 192
                         588999****************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.915127213IPR003035RWP-RK domain
PfamPF020421.6E-20145192IPR003035RWP-RK domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0051302Biological Processregulation of cell division
Sequence ? help Back to Top
Protein Sequence    Length: 312 aa     Download sequence    Send to blast
MGSDQSNFEF IMTKQDNHQD LLSLPPQLPS LDDFSEFSGH YAIDYQYDLS IQENTNPLME  60
MECTLEDPFY SSFYSLTPGE LCYDEIGNEV RMLNEMSGEL IGNGHQQVLL CDNINQQEIV  120
GNEEIIVTEK EKDNIREEIN SSRMLSRDAI SKYFYMPITR AAKELNIGLT LLKKRCRDLG  180
IRRWPHRKLM SLQTLIKNVK ELEKVGGNGM EEKLKDVIKL LEKEKKKMEE IPDMELEEKT  240
KRLRQACFKA NYKRRRLLCM PELHASFGSY CSTTPSLDDN VAIGDQHEED DEEIKSLLAD  300
CFSYNSPTLH D*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1252256KRRRL
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc03g116010.1.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019068278.21e-171protein RKD2
TrEMBLA0A3Q7FR770.0A0A3Q7FR77_SOLLC; Uncharacterized protein
STRINGSolyc03g116010.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA42742142
Representative plantOGRP5671777
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18790.13e-40RWP-RK domain-containing protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]