PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc03g114850.2.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family SBP
Protein Properties Length: 266aa    MW: 29468.4 Da    PI: 9.8352
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc03g114850.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP135.81.3e-42167242277
                         -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
                 SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                         Cqv+gC +dls +k+yh+rhkvCevhsk+++v+v+g+eqrfCqqCsrfh l efD++krsCr+rLa+hnerrrk+ 
  Solyc03g114850.2.1 167 CQVQGCGKDLSPCKDYHKRHKVCEVHSKTAKVIVNGIEQRFCQQCSRFHLLAEFDDGKRSCRKRLAGHNERRRKPP 242
                         **************************************************************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.8E-34161228IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.701164241IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.44E-39165244IPR004333Transcription factor, SBP-box
PfamPF031104.2E-32167240IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 266 aa     Download sequence    Send to blast
MESWSYFSGG KGFVSEESVS VNDGMRRVKN GVMGWELKTQ SSYGMCTTDN QGFHELGSPN  60
LMRKPMFTDQ MRDGFASSKH WGGGGGSIVG AFSGEDKSSS KLSSSAVDSI SRDSSLIDLK  120
LGRFPDHHVD GNIFKSAKTL SSSTSAESIL PAKRMRAGGL NSHKPFCQVQ GCGKDLSPCK  180
DYHKRHKVCE VHSKTAKVIV NGIEQRFCQQ CSRFHLLAEF DDGKRSCRKR LAGHNERRRK  240
PPHTGMYQIS WNFFCNVTLC MPRHT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-301662401084squamosa promoter binding protein-like 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.20910.0flower| fruit| leaf
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc03g114850.2.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0134570.0Lycopersicon esculentum clone 132113R, mRNA sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001334260.11e-180squamosa promoter-binding-like protein
TrEMBLA0A3Q7FQM41e-179A0A3Q7FQM4_SOLLC; Uncharacterized protein
STRINGSolyc03g114850.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51871639
Representative plantOGRP9717230
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.12e-47SBP family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]