PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc03g113620.2.1
Common NameLOC101262503
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family MYB_related
Protein Properties Length: 316aa    MW: 34039.7 Da    PI: 9.6686
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc03g113620.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.82.9e-14116160347
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         +WT+eE++l++ + ++ G+g+W+ I+r + k+Rt+ q+ s+ qky
  Solyc03g113620.2.1 116 PWTEEEHKLFLLGLQKVGKGDWRGISRNFVKTRTPTQVASHAQKY 160
                         8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.67109165IPR017930Myb domain
SuperFamilySSF466896.58E-17111165IPR009057Homeodomain-like
TIGRFAMsTIGR015575.7E-17112163IPR006447Myb domain, plants
SMARTSM007171.8E-10113163IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.1E-11115160IPR009057Homeodomain-like
CDDcd001671.90E-9116161No hitNo description
PfamPF002491.9E-11116160IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006338Biological Processchromatin remodeling
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0035066Biological Processpositive regulation of histone acetylation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003682Molecular Functionchromatin binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0003713Molecular Functiontranscription coactivator activity
GO:0004402Molecular Functionhistone acetyltransferase activity
Sequence ? help Back to Top
Protein Sequence    Length: 316 aa     Download sequence    Send to blast
MMSSFCSQSA NDGHNSFTCA GESSPAAVSV GGGVGGGGEI MLFGVRVKVD PMRKSVSLNN  60
LSQYEQPNSN DNNNNNSNSG NNNDASKVAA DEGYASADDA VPHHSGSGRE RKRGVPWTEE  120
EHKLFLLGLQ KVGKGDWRGI SRNFVKTRTP TQVASHAQKY FLRRTNLNRR RRRSSLFDIT  180
TDSVSVLATE ETKNLQRHSI PSLPCIETSK MNAFQVTSVP VNFGPENPIE SPILRQGNQS  240
YYNGSSSIFL RPAPVVVSLP NSSKTADFNL NQSSAMETSS LSLTLSLSPS SSSTRHSGFQ  300
VMSNFKNGES IISVA*
Functional Description ? help Back to Top
Source Description
UniProtBinds selectively to the DNA sequence 5'-[GA]GATAA-3' and may act as a transcription factor involved in the regulation of drought-responsive genes. Enhances stomatal closure in response to abscisic acid (ABA). Confers drought and salt tolerance. {ECO:0000269|PubMed:21030505}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00631PBMTransfer from PK23829.1Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc03g113620.2.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated by drought, high salinity, and ABA. {ECO:0000269|PubMed:21030505}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004236161.10.0transcription factor MYB1R1
SwissprotQ2V9B01e-93MY1R1_SOLTU; Transcription factor MYB1R1
TrEMBLA0A3Q7FSP50.0A0A3Q7FSP5_SOLLC; Uncharacterized protein
STRINGSolyc03g113620.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA25742351
Representative plantOGRP3941699
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G74840.26e-56MYB_related family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]
  2. Shin D, et al.
    Expression of StMYB1R-1, a novel potato single MYB-like domain transcription factor, increases drought tolerance.
    Plant Physiol., 2011. 155(1): p. 421-32
    [PMID:21030505]