PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc03g113530.2.1
Common NameLOC101250007
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family MYB_related
Protein Properties Length: 356aa    MW: 39641.1 Da    PI: 6.3109
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc03g113530.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding38.72.4e-1272113346
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                         ++T++E+el++++++  G++ W+ Ia+ +  gRt++++k+ w++
  Solyc03g113530.2.1  72 SFTPQEEELIIKLHATIGSR-WSIIAQQLA-GRTDNDVKNLWNT 113
                         79******************.*********.**********997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500904.3443164IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.601.0E-93171IPR009057Homeodomain-like
SuperFamilySSF466891.07E-1755123IPR009057Homeodomain-like
PROSITE profilePS5129420.25565119IPR017930Myb domain
SMARTSM007171.0E-1069117IPR001005SANT/Myb domain
PfamPF002493.4E-1172113IPR001005SANT/Myb domain
CDDcd001673.33E-872115No hitNo description
Gene3DG3DSA:1.10.10.601.6E-2172119IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 356 aa     Download sequence    Send to blast
MGRPPCCNDK VHNRKCNWIE EDANTSTFVS INKHGIGNWA TMSKKSGHGR CGGRNQKQRW  60
NNRLKPDLKQ DSFTPQEEEL IIKLHATIGS RWSIIAQQLA GRTDNDVKNL WNTKLKKKLS  120
AMGIDPVTHK PFSQILTDYG NIGGFPKART RFVSLNRELK GAFMSRPEQL QHSLQNFQNF  180
NSLCVKLPKT EASEECFFSN NQDSSNINQP PVDLFSELQA IKFVTEASNY NSPKAVFSHN  240
PNPITDCSTS SPLSSSSSSS ASHSLADNQV NWCDYLLDDE FLPSNFKAQE DTLTIEEKLV  300
CGGAEDGSNN VPSTKDFENS LSTKGTSSSS FVEAMLECEN DMFLNFPGLS EDPFY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-171811910108B-MYB
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc03g113530.2.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004236519.10.0transcription factor MYB35
TrEMBLA0A3Q7GFI40.0A0A3Q7GFI4_SOLLC; Uncharacterized protein
STRINGSolyc03g113530.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA123481922
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28470.14e-45MYB family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]