PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc03g098320.2.1
Common NameLOC101255972
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family MYB_related
Protein Properties Length: 459aa    MW: 49794.5 Da    PI: 5.3748
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc03g098320.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.22.5e-155599147
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                        r +WT+eE++++++a k++G   W+ I +++g  +t+ q++s+ qk+
  Solyc03g098320.2.1 55 REKWTEEEHQRFLEALKLYGRA-WRQIEEYVG-SKTAIQIRSHAQKF 99
                        789*****************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466898.97E-1649103IPR009057Homeodomain-like
PROSITE profilePS5129421.17950104IPR017930Myb domain
TIGRFAMsTIGR015572.3E-1753102IPR006447Myb domain, plants
SMARTSM007173.6E-1254102IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-85595IPR009057Homeodomain-like
PfamPF002491.7E-125598IPR001005SANT/Myb domain
CDDcd001673.75E-957100No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007623Biological Processcircadian rhythm
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0046686Biological Processresponse to cadmium ion
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 459 aa     Download sequence    Send to blast
MVADAVNQVE GSQQGASSMI SSKLETVATQ GKAPTCLANE NVLKARKPYT ITKQREKWTE  60
EEHQRFLEAL KLYGRAWRQI EEYVGSKTAI QIRSHAQKFF AKVARDSGND GDESLNAIDI  120
PPPRPKKKPL HPYPRKMADS SIANKAVSGQ PERSPSPNAS GRESCSPDSV LPAIGLGIAE  180
YSVAEQQNSR FSPVSCTTDA HTANIISTEN DDESMSSNSN NVDAIHVTLK PVAASISLIT  240
NSEFMECNIV HMENSCNGEK LAVEPPSASI KLFGKTVFVP DANNLAPPAP YNTEKEKEIS  300
NEDVLHGFQA NQANSPFVLA MVPGNMIPPA SWLSQNMLEN NRESTAAFPA ATISWWSWYQ  360
DLLYRSISSC GQTTVEAASH CQGLKDEEPQ REGSSTGSSI GSASEVDDGN TSCETVESKC  420
TTKIKGFVPY KRCLAERDGK SSGAVLEERE SQRVRVCS*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.81420.0callus| fruit| leaf| root
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00146DAPTransfer from AT1G18330Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc03g098320.2.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004235390.10.0protein REVEILLE 7
TrEMBLA0A3Q7FNA00.0A0A3Q7FNA0_SOLLC; Uncharacterized protein
STRINGSolyc03g098320.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA74472127
Representative plantOGRP12551549
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18330.12e-36MYB_related family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]