PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc03g098260.1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family MYB_related
Protein Properties Length: 42aa    MW: 4769.4 Da    PI: 9.4063
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc03g098260.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding422.1e-13440138
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HH CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlk 38
                        rg W + Ede+l ++v+++G+++W++Ia  ++ gR++ 
  Solyc03g098260.1.1  4 RGHWRPHEDEKLRELVAKYGPHNWNAIALNLQ-GRSGL 40
                        899*****************************.**986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.506141IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.1E-13340IPR009057Homeodomain-like
SuperFamilySSF466891.36E-10341IPR009057Homeodomain-like
PfamPF002493.1E-12441IPR001005SANT/Myb domain
CDDcd001671.13E-9741No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 42 aa     Download sequence    Send to blast
MCSRGHWRPH EDEKLRELVA KYGPHNWNAI ALNLQGRSGL Q*
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: In elongating stem internodes, expressed in developing protoxylem and elongating interfascicular fiber cells. In non-elongating internodes, expressed in developing metaxylem cells and interfascicular fibers. In roots, expressed in developing secondary xylem. {ECO:0000269|PubMed:18952777}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that regulates secondary cell wall (SCW) biosynthesis, especially in interfascicular and xylary fibers. {ECO:0000269|PubMed:18952777}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc03g098260.1.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006364392.11e-21PREDICTED: transcriptional activator Myb-like isoform X1
RefseqXP_006364393.11e-21PREDICTED: transcriptional activator Myb-like isoform X2
RefseqXP_010318340.11e-21transcription factor MYB54-like
RefseqXP_015069302.11e-21transcription factor MYB54-like isoform X1
RefseqXP_015069303.11e-21transcription factor MYB54-like isoform X2
SwissprotQ9FX362e-17MYB54_ARATH; Transcription factor MYB54
TrEMBLA0A3Q7FNT73e-21A0A3Q7FNT7_SOLLC; Uncharacterized protein
TrEMBLM1D2B82e-20M1D2B8_SOLTU; Uncharacterized protein
STRINGSolyc03g098260.1.12e-23(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73410.17e-20myb domain protein 54
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]
  2. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]