PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc03g097650.2.1
Common NameLOC101262704
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family NAC
Protein Properties Length: 257aa    MW: 29326 Da    PI: 8.201
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc03g097650.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM142.32.9e-44141391128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                         lppGfrF+Ptdee+v +yL +k+ + +l++ ++i+e++i+k +Pw+Lp  v   e++ yfFs+++ ky++g+r+nrat  gyWk +g dk+
  Solyc03g097650.2.1  14 LPPGFRFQPTDEEIVFQYLIRKTFSCPLPA-SIIPEINICKNDPWNLPGDV---EQDRYFFSNKEAKYRNGNRANRATIGGYWKPSGLDKQ 100
                         79****************************.89***************554...5689********************************* PP

                 NAM  92 vlsk.kgelvglkktLvfykg.rapkgektdWvmheyrl 128
                         ++++ ++  vg+kktLvfykg +a+++ +tdW+mheyrl
  Solyc03g097650.2.1 101 IICSkRKPIVGMKKTLVFYKGkSASQAYRTDWIMHEYRL 139
                         999745556**********995678889*********98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.83E-4911178IPR003441NAC domain
PROSITE profilePS5100549.55614178IPR003441NAC domain
PfamPF023651.2E-2315139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 257 aa     Download sequence    Send to blast
MDKFNFVKDG AIKLPPGFRF QPTDEEIVFQ YLIRKTFSCP LPASIIPEIN ICKNDPWNLP  60
GDVEQDRYFF SNKEAKYRNG NRANRATIGG YWKPSGLDKQ IICSKRKPIV GMKKTLVFYK  120
GKSASQAYRT DWIMHEYRLV LPKNSSSNLH VHFNKSSSQQ NNSLVQIGNW VLCHIFLKKR  180
NGKCDEEIIE ANCHDDNYKA NDEHNDVVYY DFMREDNLSD SRAAASSCSS SLSINNDDAN  240
EVSSCPTSLL QHQQPL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-391218315170NO APICAL MERISTEM PROTEIN
1ut4_B3e-391218315170NO APICAL MERISTEM PROTEIN
1ut7_A3e-391218315170NO APICAL MERISTEM PROTEIN
1ut7_B3e-391218315170NO APICAL MERISTEM PROTEIN
4dul_A3e-391218315170NAC domain-containing protein 19
4dul_B3e-391218315170NAC domain-containing protein 19
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Up-regulated during xylem vessel element differentiation. {ECO:0000269|PubMed:20388856}.
UniprotTISSUE SPECIFICITY: Expressed in xylem and phloem cells in roots and inflorescence stems (PubMed:20388856). Highly expressed in senescent leaves. Expressed in roots, and abscission and dehiscence tissues, such as axils of bracts and abscission zones in cauline leaves and siliques (PubMed:21673078). {ECO:0000269|PubMed:20388856, ECO:0000269|PubMed:21673078}.
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional repressor that negatively regulates the expression of genes involved in xylem vessel formation. Represses the transcriptional activation activity of NAC030/VND7, which regulates protoxylem vessel differentiation by promoting immature xylem vessel-specific genes expression (PubMed:20388856). Transcriptional activator that regulates the COLD-REGULATED (COR15A and COR15B) and RESPONSIVE TO DEHYDRATION (LTI78/RD29A and LTI65/RD29B) genes by binding directly to their promoters. Mediates signaling crosstalk between salt stress response and leaf aging process (PubMed:21673078). May play a role in DNA replication of mungbean yellow mosaic virus (PubMed:24442717). {ECO:0000269|PubMed:20388856, ECO:0000269|PubMed:21673078, ECO:0000269|PubMed:24442717}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc03g097650.2.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By abscisic acid (ABA) and salt stress. {ECO:0000269|PubMed:21673078}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2327763e-07Solanum lycopersicum chromosome 2 clone C02SLm0132H19, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004235471.10.0NAC domain-containing protein 83
SwissprotQ9FY932e-70NAC83_ARATH; NAC domain-containing protein 83
TrEMBLA0A3Q7GCT80.0A0A3Q7GCT8_SOLLC; Uncharacterized protein
STRINGSolyc03g097650.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13872377
Representative plantOGRP1715800
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13180.12e-71NAC domain containing protein 83
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]
  2. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  3. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]