PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc03g096630.1.1
Common NameLOC101260322
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family EIL
Protein Properties Length: 435aa    MW: 50289.9 Da    PI: 6.0154
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc03g096630.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3352.58.6e-108292982286
                         XXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
                EIN3   2 elkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasdsLr 92 
                         +lkkrmwkd+m+l++lk ++  +  +k+   + +++ k +eq+rrkkmsraQD+iLkYM+k+mevc+ qGfvYgi+ ekgkpv g+sdsLr
  Solyc03g096630.1.1  29 DLKKRMWKDRMKLEKLKAKRDMSS-SKDD--SDETEAKQEEQSRRKKMSRAQDSILKYMVKIMEVCQGQGFVYGIVGEKGKPVCGSSDSLR 116
                         9*************9999888755.3333..34556899**************************************************** PP

                         XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--HHHH---S--HHHHH CS
                EIN3  93 aWWkekvefdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtGkelwwge 183
                         +WWkekv+f++ +paai++    +l+ + +     + ss  h l++l D tl+ LLs+lmqhc ppqr fple+g++pPWWPtGkelwwg 
  Solyc03g096630.1.1 117 EWWKEKVRFEQSAPAAIADF-LPKLVED-NII--LDTSSHIHHLEDLRDGTLSTLLSTLMQHCHPPQRIFPLERGLAPPWWPTGKELWWGD 203
                         *******************9.3455533.222..357999*************************************************** PP

                         HT--TT--.-----GGG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S--XXXXXXXXXXXXXXX CS
                EIN3 184 lglskdqgtppykkphdlkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvlnqeekecatvsahssslrkqspkv 274
                         +gls++qg+ppy+kphdlkkawk++vL+a ik m p+++++r+ + qs++lq+km+ake++++++ +nqee++++    + +         
  Solyc03g096630.1.1 204 QGLSQEQGPPPYRKPHDLKKAWKITVLAAIIKNMTPNLDRMRRFVTQSRSLQNKMTAKETATWSKLVNQEEALVNLTDKSLK--------- 285
                         ************************************************************************9964444422......... PP

                         XXXXXXXXXXX..X CS
                EIN3 275 tlsceqkedve..g 286
                          +s+++ke+    +
  Solyc03g096630.1.1 286 -ISSSHKEEDLslV 298
                         .2222221111121 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048735.5E-10928274No hitNo description
Gene3DG3DSA:1.10.3180.102.2E-61150279IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167683.79E-55153277IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009873Biological Processethylene-activated signaling pathway
GO:0071281Biological Processcellular response to iron ion
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 435 aa     Download sequence    Send to blast
MVKVDEIVEP WGDPMRELLE VEENISYNDL KKRMWKDRMK LEKLKAKRDM SSSKDDSDET  60
EAKQEEQSRR KKMSRAQDSI LKYMVKIMEV CQGQGFVYGI VGEKGKPVCG SSDSLREWWK  120
EKVRFEQSAP AAIADFLPKL VEDNIILDTS SHIHHLEDLR DGTLSTLLST LMQHCHPPQR  180
IFPLERGLAP PWWPTGKELW WGDQGLSQEQ GPPPYRKPHD LKKAWKITVL AAIIKNMTPN  240
LDRMRRFVTQ SRSLQNKMTA KETATWSKLV NQEEALVNLT DKSLKISSSH KEEDLSLVHK  300
NVFIDKSARR RKYKRKCNFE HDTRCPYREN GGLNDQESIN CEDQLEAQTL PREEWIAKEE  360
EISPHDWMNM EIQKSFNNYD AQFTACGGIQ KNFESYSGEN HVLEQLLSDP ETCGSINIDG  420
TQSEAEIATS IWEF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4zds_A1e-521512771127Protein ETHYLENE INSENSITIVE 3
4zds_B1e-521512771127Protein ETHYLENE INSENSITIVE 3
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1309315RRKYKRK
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor that may be involved in the ethylene response pathway. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc03g096630.1.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3287851e-07Lycopersicon esculentum EIL2 (EIL2) mRNA, complete cds
GenBankBT0137831e-07Lycopersicon esculentum clone 132674F, mRNA sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004235464.10.0putative ETHYLENE INSENSITIVE 3-like 4 protein
SwissprotQ9LX161e-112EIL4_ARATH; Putative ETHYLENE INSENSITIVE 3-like 4 protein
TrEMBLA0A3Q7FMU20.0A0A3Q7FMU2_SOLLC; Uncharacterized protein
STRINGSolyc03g096630.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA30423178
Representative plantOGRP5631682
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G10120.11e-114EIL family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]
  2. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  3. Jeong HJ,Choi JY,Shin HY,Bae JM,Shin JS
    Seed-specific expression of seven Arabidopsis promoters.
    Gene, 2014. 553(1): p. 17-23
    [PMID:25261846]