PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc03g083040.1.1
Common NameLOC101253567
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family Nin-like
Protein Properties Length: 265aa    MW: 31049.2 Da    PI: 5.8826
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc03g083040.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK83.61.9e-26151200352
              RWP-RK   3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                         ++++le++++yF+ pi++AAkeL v+lTvLK++CR+++I+RWPhRk+ksl
  Solyc03g083040.1.1 151 DTLELEEIQRYFHVPITKAAKELRVGLTVLKKRCRELNIMRWPHRKLKSL 200
                         789*********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.632134222IPR003035RWP-RK domain
PfamPF020421.2E-23152200IPR003035RWP-RK domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009793Biological Processembryo development ending in seed dormancy
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 265 aa     Download sequence    Send to blast
MDVKSQVLDV LKMENQNDHF DWLYSEQEYP PSTFGTLQQD SRLSNGGLLN FEFDPFELPN  60
DLQNNNLPYF GLEEFEEICQ DLGSFDLKSL PSQFQEDNNT LIIHDANVNV MPQNVTHDTL  120
GESQVTTPAF YGDSMEIIQN RNNNRRHKKS DTLELEEIQR YFHVPITKAA KELRVGLTVL  180
KKRCRELNIM RWPHRKLKSL QTLIHNVKEM GLTSEVEMLE EHQRMVERVP EMELTDRTKK  240
LRQTCFKANY KKRRASMAMT ANFY*
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc03g083040.1.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010318117.10.0protein RKD3
TrEMBLK4BI800.0K4BI80_SOLLC; Uncharacterized protein
STRINGSolyc03g083040.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA121431922
Representative plantOGRP5671777
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53040.12e-44RWP-RK domain-containing protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]