PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc03g082840.2.1
Common NameLOC101266004
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family Dof
Protein Properties Length: 259aa    MW: 28102 Da    PI: 8.4572
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc03g082840.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.41.8e-393191262
              zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                        ke+a++cprC+stntkfCyynnysl+qPryfCk+CrryWt+GG+lrnvPvGgg+rknk+s+
  Solyc03g082840.2.1 31 KEQAVNCPRCNSTNTKFCYYNNYSLTQPRYFCKTCRRYWTEGGSLRNVPVGGGSRKNKRSN 91
                        7899******************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074784.0E-272483IPR003851Zinc finger, Dof-type
PfamPF027011.6E-333389IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.0033589IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103773IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 259 aa     Download sequence    Send to blast
MDTSPQWPQG IGIVKGVDEA KLDQRKPRPQ KEQAVNCPRC NSTNTKFCYY NNYSLTQPRY  60
FCKTCRRYWT EGGSLRNVPV GGGSRKNKRS NSISISSSST TSSLSLSSSS KKLFTDLANP  120
NDLNLTYNPI PSGGTTTTTA TNFSNFSDFM ALPLLHPSAN SASTFMTSSN LYPSSTTGIS  180
NLHDLKSSNG INFSLDGFEN GYGSLPSHQE AKLFFPMDDL KINVSTVGDE QFEENRGQAA  240
DQSNGFWNGM LGGGGTSW*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.257560.0callus| flower| fruit| root
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc03g082840.2.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004234992.10.0dof zinc finger protein DOF4.6 isoform X1
TrEMBLA0A3Q7FMT80.0A0A3Q7FMT8_SOLLC; Uncharacterized protein
STRINGSolyc03g082840.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8824419
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24060.15e-38Dof family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]