PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc03g082430.1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family GRF
Protein Properties Length: 459aa    MW: 50424.7 Da    PI: 6.416
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc03g082430.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC72.74.3e-23117159244
                 WRC   2 aepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                          epgrC+RtDGKkWRCsr+v + +k+CErH+hrgr rsrk++e
  Solyc03g082430.1.1 117 LEPGRCKRTDGKKWRCSRDVAPHQKYCERHMHRGRPRSRKHVE 159
                         69***************************************98 PP

2QLQ514.4e-185993236
                 QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiq 36
                        +FT+aQ+ +L++Q+++yKy+++ + vPp+Ll+ i+
  Solyc03g082430.1.1 59 PFTWAQWKELERQAMIYKYMVSAMSVPPDLLLSIS 93
                        9******************************9996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009517.4E-115894IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166619.7975994IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088801.1E-125992IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.213116160IPR014977WRC domain
PfamPF088794.1E-19118159IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010114Biological Processresponse to red light
GO:0010218Biological Processresponse to far red light
GO:0080167Biological Processresponse to karrikin
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 459 aa     Download sequence    Send to blast
MGHHQDVHCS DGGANKMLCS TDEASLLPPP PSAPVVRSLQ PFDVATNSQG GMTTTLGYPF  60
TWAQWKELER QAMIYKYMVS AMSVPPDLLL SISSEASHTT SATGSVQGRY TTNIRDLEPG  120
RCKRTDGKKW RCSRDVAPHQ KYCERHMHRG RPRSRKHVEV HAGVSNASDN KKTRLQAESI  180
PTTTASQINN RSTKQPLRST FQQIQNPLSF HDDKIGGNGI ISDSSFNELH RSSGWMMEGE  240
LVAKADSGHQ WQHLMDSNAG YSAHGYREEA LNFLVSRDME RTEHTGEFNF MTNPEFVKDT  300
SRDLINGWSN DNVYNNSNNE NLEASLWPSL GDISSSSLAL SIAMAAGDVL DEDMGLDSRF  360
MNTNQHKFWE NSFPFASGGP LAEVLHPSSS FSLGDNPTSS YTSNGDSISP AATTVSSPSG  420
VLQKTMFSHS DGSVCNSPIL AAPSNNITPE TVQFQWLR*
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc03g082430.1.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0109401e-142Solanum lycopersicum DNA, chromosome 8, clone: C08HBa0195L01, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010318056.10.0growth-regulating factor 3-like
TrEMBLK4BI190.0K4BI19_SOLLC; Uncharacterized protein
STRINGSolyc03g082430.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA70322230
Representative plantOGRP1109257
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53660.16e-37growth-regulating factor 7
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]