PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc03g044690.1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family FAR1
Protein Properties Length: 350aa    MW: 40826.6 Da    PI: 9.2386
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc03g044690.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR126.61.9e-08881403790
                FAR1  37 kegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHela 90 
                         ++g ++++++k+ +++r+r e r+gC a++k k + +  wev +++ eH+H++ 
  Solyc03g044690.1.1  88 RKGPKTHNRNKEMTRKRQRLEYRCGCLAHIKFKIS-NVIWEVCEFSDEHSHPMI 140
                         45556666666799999****************99.9**************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031015.0E-685140IPR004330FAR1 DNA binding domain
PfamPF105516.4E-22262343IPR018289MULE transposase domain
Sequence ? help Back to Top
Protein Sequence    Length: 350 aa     Download sequence    Send to blast
MIYSTFIQSL TKLVIVYSII YSSYFDTYHL KIVIVAHNVN DQKYSTRTHN VSSINKKFVF  60
EIGMKFVSEE YSCNAYNSYD VAKGFEIRKG PKTHNRNKEM TRKRQRLEYR CGCLAHIKFK  120
ISNVIWEVCE FSDEHSHPMI EYNLRHFIQS GRKLTNSTKN ILGSMLDAGI RTKKVVRYLQ  180
YEEGGIENAG FIEQDAHKFV QAHKRNMISS GDAQTLINHF RHLHSEDSKF FYSFQVDEDG  240
RLCNFFWRDS ISRLHYQCFG DVTIFDTTYR TNRYNMICSP FVGVNNHWKN VFFLCAFSCN  300
ETTDSFVCLF QTFLKGMGGK TPKTIFKDQD HAMAAVIRQV FPKHISSIV*
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc03g044690.1.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2331260.0Solanum lycopersicum strain Heinz 1706 chromosome 1 clone hba-162g22 map 1, complete sequence
GenBankAC2469460.0Solanum lycopersicum chromosome 3 clone HBa0188D04, complete sequence
GenBankAC2470100.0Solanum lycopersicum chromosome 3 clone HBa0188D04, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019261901.11e-113PREDICTED: protein FAR1-RELATED SEQUENCE 5-like
TrEMBLK4BG860.0K4BG86_SOLLC; Uncharacterized protein
STRINGSolyc03g044690.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA1726931
Representative plantOGRP3012351
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.15e-51FAR1-related sequence 5
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]