PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc03g043840.1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family bZIP
Protein Properties Length: 171aa    MW: 20097.7 Da    PI: 4.9223
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc03g043840.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_131.73.4e-1051110463
                         XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                          k+ rr ++NR++A+rsR RK ++i+ L++++k Le+    L  ++e+ k++ +kl+ e+
  Solyc03g043840.1.1  51 MKKLRRTISNRLSAQRSRMRKTEYIDLLRKEAKDLEERIAFLGRKIENDKDNNKKLQLEN 110
                         6999***************************************************99887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003387.2E-548119IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.08250113IPR004827Basic-leucine zipper domain
PfamPF001701.4E-951110IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.03E-951106No hitNo description
Gene3DG3DSA:1.20.5.1702.3E-952107No hitNo description
CDDcd147023.65E-75397No hitNo description
PROSITE patternPS0003605570IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 171 aa     Download sequence    Send to blast
MNEKRIKSDE PHLSLSLKTS IEYESVNRIS SLEEALNSEI KHGQVDPNMN MKKLRRTISN  60
RLSAQRSRMR KTEYIDLLRK EAKDLEERIA FLGRKIENDK DNNKKLQLEN QMLQLQLDSI  120
TNKSNLLAEL EAELKRLKEL EDEEDEEYID IDQYLNFDNM NISPFRIDGI *
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc03g043840.1.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015069612.28e-93basic leucine zipper 34-like
TrEMBLA0A3Q7G5S91e-115A0A3Q7G5S9_SOLLC; Uncharacterized protein
STRINGSolyc03g043840.1.11e-116(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA76151929
Representative plantOGRP1346725
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G07160.18e-08bZIP family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]