PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc03g043820.1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family bZIP
Protein Properties Length: 127aa    MW: 14831.2 Da    PI: 10.3764
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc03g043820.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_130.86.2e-1049106461
                         XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklks 61 
                          k+ rr ++NR++A+rsR RK ++i+ L++++k Le+       ++e+ k++ +kl+ 
  Solyc03g043820.1.1  49 MKKLRRTISNRLSAQRSRMRKTQYIDLLKKEAKDLEEMIAFFGRKIENDKDNNKKLQL 106
                         699*********************************9888888888888888777765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003380.002646110IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.44E-949104No hitNo description
PfamPF001704.1E-949107IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1709.8E-1150105No hitNo description
PROSITE patternPS0003605368IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 127 aa     Download sequence    Send to blast
MNEKRIKSDE PRLSLSLKTP FESVNKIPSL EEALNSELEH GQVDPNMNMK KLRRTISNRL  60
SAQRSRMRKT QYIDLLKKEA KDLEEMIAFF GRKIENDKDN NKKLQLETSL TNLIYSQCKM  120
KSWKLS*
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc03g043820.1.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015069615.27e-67transcription factor HY5-like
TrEMBLK4BG022e-85K4BG02_SOLLC; Uncharacterized protein
STRINGSolyc03g043820.1.14e-86(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA76151929
Representative plantOGRP1346725
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G07160.11e-08bZIP family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]