PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc03g006900.1.1
Common NameLOC101253357
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family Trihelix
Protein Properties Length: 978aa    MW: 109937 Da    PI: 7.4864
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc03g006900.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix285.7e-092032601875
            trihelix  18 eerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtses 75 
                         +  ++rgk ++ + +ev++++ ++g++r +k+   kw+n+ ++++k+ e+e++ + e+
  Solyc03g006900.1.1 203 GAGSGRGKTRADKDREVAEFLNRHGVNRDAKTAGTKWDNMLGEFRKVYEWERGAEREQ 260
                         55667899999999**************************************975444 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.510.105.6E-6803924No hitNo description
SuperFamilySSF561122.82E-16824961IPR011009Protein kinase-like domain
CDDcd001803.85E-18824962No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 978 aa     Download sequence    Send to blast
MDENKGDTTK KQHLSNSPVD PHEQDSPDNT IPLQHPVVSA APYISSSALY NIPTAAAATS  60
FEQQHQFDAV NTKRPRYTSS QWKFISSHHQ QQQQQKAGTI LSAESSPISP TAHATTATNI  120
PQTQVPTASS SDTASSPSHS PRPCSEPSKS EGGEQVHQQF RKGKYVSPVW KPNEMLWLAR  180
AWKIQYQGSG SSSELVHLEG SPGAGSGRGK TRADKDREVA EFLNRHGVNR DAKTAGTKWD  240
NMLGEFRKVY EWERGAEREQ IGKSYFRLSP YERKIHRLPA SFDEQVFEEL SQFMGSRMRT  300
PQTRIGTQSN SIADDIPTPL IVTKSLPPPP PPFREDELPH SARAKQLVMS RGTETLIHGT  360
RGGFLGFETV QPSSSLDIMG GGPSSSGSKE LRRIGKIRMI WEESVSLWAE EGEHHRGRVK  420
LQGCSFLNAD EIAFLDDSMV ASTMEAFEDG PMKGFSVDRF QSGIQLKVFG RRKSSSPIAP  480
CGPSERLQLP SSEFPIRSTT PWEFQDPTEY YVGCLRSPPP TLPTLFELSW HLQQPPPEEL  540
RFPLRRDVFK DLPQGRELFF TTSSTELLDC RGITYDVLTC IMRSNPSLNA ATATDRDSYI  600
GLWDDCINRM ISKFCSIEMV FVRKSSSSLA ETVQDQWPNV TAFLRNFCLW RGEETDQLRE  660
GQLDPSSSIV EKFLWSYMDL PYVLGYYAVG FIVTFCALSR SQERIIRTDL YTVDLSTPVE  720
RLKALVPCWR IAGLLPLLAD KCFHYMSSNF KHLLYTDFER TDFGNGNFME MTPNTVVRYF  780
SSKRKWLGMK EIYDFLDHRI PHAEFVVRAS EKDLALVFKP RGCKFKPVNC DQLIEALKQV  840
TKALVALHDL SFMHRDLGWD KVMRRIDREN EWFITGFDEA VTAPQLYPHG GAAAAGTTGI  900
GRHPPEMGRN YHGVKVDVWG IGQLVKSCGL VGVPKLLREL QNRCLDHNPE QRPTAADCYR  960
HLLQLQSSIS AAAAGGY*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004234266.10.0PREDICTED: uncharacterized protein LOC101253357
TrEMBLK4BEB30.0K4BEB3_SOLLC; Uncharacterized protein
STRINGSolyc03g006900.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP947967
AsteridsOGEA129361416
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33550.16e-09Trihelix family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]